DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31773 and Nphs1

DIOPT Version :9

Sequence 1:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_072150.1 Gene:Nphs1 / 64563 RGDID:620460 Length:1252 Species:Rattus norvegicus


Alignment Length:515 Identity:100/515 - (19%)
Similarity:169/515 - (32%) Gaps:172/515 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KPTQPQSQPSQSQSSATQPTQPPQQAEIKKNPLTMGAISPAPPT-------PISPKPSVQPKIPD 110
            |.::|.|:|.|.|.        |::.:       :|::..:..|       .|.|        ||
  Rat   494 KDSRPVSEPRQPQE--------PRRVQ-------LGSVEKSGSTFSRELVLIIGP--------PD 535

  Fly   111 QRAKWMAKVSPESQRKAKLAAAGGSPPSGPPKNQFSQANNPSFAMPGQS---SPANFSAAPKTQA 172
            .|||:..|.       .:|:|:.......||.|....||: |...||.:   :..:.|:.|....
  Rat   536 NRAKFSCKA-------GQLSASTQLVVQFPPTNLTILANS-SALRPGDALNLTCVSISSNPPVNL 592

  Fly   173 SWQ---QKVEKSAENEDSGAFKG-ASSESQRKNWMNRMQGSQQ--RKQNQWLKE----------M 221
            ||.   :::|..|....|..||| |:|.|......:|..|.:.  |..::.|:|          :
  Rat   593 SWDKEGERLEDVAAKPQSAPFKGSAASRSVFLRVSSRDHGQRVTCRAHSEALRETVSSFYRFNVL 657

  Fly   222 QAKQQAGKDIQAQKMQKMESQKATTTPAAPPKEAAPST---------PQPAEKP----------- 266
            ...:..|:.::|..:.:   |.....|.:.....||..         ..||..|           
  Rat   658 YPPEFLGEQVRAVTVVE---QGQVLLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQ 719

  Fly   267 ------------------EEKSPEHLAYLDAIKQLNSYQVLEPTS---GRATTKSSRKEQDPVIE 310
                              .|.:.|.|..||.........:.:||.   |.:.......:.:|::.
  Rat   720 LWNVTRADDGFYQLHCQNSEGTAEALLKLDVHYAPTIRALRDPTEVNVGGSVDIVCTVDANPILP 784

  Fly   311 QTLECLEKSGLTKKDLKAIPVIQVA-GSKGR-----------GSTCAIVESILRCHGVKTGVLSS 363
            :... .|:.|..::||....:.:|: ||.||           |:...||:     :||.......
  Rat   785 EMFS-WERLGEEEEDLNLDDMEKVSKGSTGRLRIRQAKLSQAGAYQCIVD-----NGVAPAARGL 843

  Fly   364 PHLFL----------------------TSERIRIDGEPLSDVQFTELFWKINTDLANMQPTPSYN 406
            ..|.:                      :|..:......:.::.||   |..|....::| .|.|.
  Rat   844 VRLVVRFAPQVDQPTPLTKVAAAGDSTSSATLHCRARGVPNIDFT---WTKNGVPLDLQ-DPRYT 904

  Fly   407 KIMTVMAFHAFHQAGVEVAILEVGNAGA----------------SDATNIASHAQTIGIT 450
            :       |.:||..|..::|.:.|..|                ||.|||    |.:.|:
  Rat   905 E-------HRYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDHTNI----QLVSIS 953

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31773NP_722953.1 folC 309..745 CDD:273659 37/192 (19%)
Nphs1NP_072150.1 Ig 52..128 CDD:299845
IG_like 52..127 CDD:214653
C2-set_2 155..242 CDD:285423
Ig_3 256..335 CDD:290638
IG_like 268..350 CDD:214653
C2-set_2 358..440 CDD:285423
I-set 460..555 CDD:254352 19/90 (21%)
Ig 472..555 CDD:299845 19/90 (21%)
Ig 563..646 CDD:299845 22/83 (27%)
IG_like 670..750 CDD:214653 11/82 (13%)
Ig 676..750 CDD:299845 10/73 (14%)
Ig_3 753..834 CDD:290638 16/86 (19%)
IG_like 762..848 CDD:214653 19/91 (21%)
Ig 848..956 CDD:299845 22/121 (18%)
IG_like 859..949 CDD:214653 20/104 (19%)
FN3 955..1049 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1043..1067
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1113..1144
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.