DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31773 and sns

DIOPT Version :9

Sequence 1:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster


Alignment Length:882 Identity:166/882 - (18%)
Similarity:267/882 - (30%) Gaps:329/882 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ALQWTIQSSQNFFKMSFKAPSIKVPKAAAIKELANKPTQPQSQPSQSQSSATQPTQPPQQAEIKK 82
            |:|||    ::.|.:.|.|.....|:.:.:.:      :.|...:...|:|:.......|.::..
  Fly   101 AVQWT----KDGFALGFSAVIPGFPRYSVLGD------RKQGIYNLRISNASINDDADYQCQVGP 155

  Fly    83 NPLTMGAISPAPPTPISPKPSVQPKIPDQRAKWMAKVSPESQRKAKLAAA---------GGSPPS 138
            ..|.....:.|..|.|||..|::.|.....:|...:.:.:.|.|..:|.|         .|:...
  Fly   156 ARLNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQIVWYRGNVEY 220

  Fly   139 GPPKNQFS----------------------------------QANNPSFAM-----------PGQ 158
            .|.|.:.:                                  :|.:|...|           ||.
  Fly   221 KPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGP 285

  Fly   159 SSPANFSAAPKTQASWQQKVEKSAENEDSGAFKGASSESQRKNWMNRMQGSQQR---------KQ 214
            .....:||....:..  |.||....:      :|.:..:|...:.|   |||.|         .:
  Fly   286 PYIEGYSAGETLRRG--QTVELMCRS------RGGNPPAQLIWYKN---GSQIRMAYRTSGRLSE 339

  Fly   215 NQWLKEMQAKQQAGK------DIQAQKMQKMESQKA-----TTTPAAPPKEA------------A 256
            |.:....:|.....:      ::.:|...|.|.:.:     |......|.||            |
  Fly   340 NIYTFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTA 404

  Fly   257 PSTPQPAEKPEEKSPEHLAYL---DAIKQLNSYQVLEPTSGRATTKSSRKEQDPVIEQTLECLEK 318
            ||.| |||         :.::   ..::...|..::.|..|..||.:.....:|           
  Fly   405 PSNP-PAE---------IKWMVGGRQVRNATSKTIVSPEGGWTTTSNITAVVEP----------- 448

  Fly   319 SGLTKKDLKAIPVIQVAGSKGRGSTCAIVESILRCHGVKTGVLSSPHLFLTSERIRIDGEPLSDV 383
               .|:.|..|         ..|....:.|:::..|.:  .||..|...|.|..:.....|...|
  Fly   449 ---NKRSLVVI---------CHGLNMQLTENVVSTHTI--NVLYPPAPPLISGYMEGQIIPAGSV 499

  Fly   384 QFTELFWKINTDLANMQPTPSYNKIMTVMAFHAFHQAGVEVAILEVGNAGASD--------ATNI 440
            |...........||.:....:..:|.:|:. .|......|:.||    |..||        |:|.
  Fly   500 QKLLCVSSGGNPLATLTWYKNDKRINSVIR-AADKSVSAEITIL----ANVSDNQAQYRCEASNS 559

  Fly   441 ASHAQTIGITTL--------------------GWEQS----SNLGNSLRDIAWAKASI------- 474
            |:.......|||                    |.|.:    |:..|....::|.|..|       
  Fly   560 ATEIPLFQSTTLSVHFAPETVKIRIEPEELRPGMEATIICDSSSSNPPAKLSWWKDGIPIEGINN 624

  Fly   475 -MKP--------EANIYTNVTQTECCEVLAQKAKQIGAQLRRVPTFNDYVEGDMNNKL-LMNKAN 529
             .||        ......||||                              :||.:: ....||
  Fly   625 TSKPGLWGGTVSTLEFRVNVTQ------------------------------EMNGQVYTCQSAN 659

  Fly   530 YSMRLNGSLAVQLAYDFLKRHKPEYV-------VGLEHNS-----------------------TL 564
            .:::.:...||.|  |.|  ::|::|       ||:|..|                       |:
  Fly   660 EALQRSAHEAVSL--DVL--YRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTI 720

  Fly   565 LTPGASRGIEIFEQPGHFDFMRHDMFNVYLDSADTFESMMACRDWFYTRTRANRQPKILL-FNKV 628
            ...|..|   ||...|..:|.|     ::.|.|.           .|:.:.:|.|....| ...|
  Fly   721 PQDGDHR---IFADGGSLNFTR-----LHRDDAG-----------IYSCSASNSQGGATLNITVV 766

  Fly   629 NEFNAKDLLTIIRS---NLRFEEACFVPNPN-------YFEGEILAEEDGKAMVWH--GME---- 677
            .|:.     |.|:|   |:       |.||.       ..||:.|.||..|   |.  |.:    
  Fly   767 VEYG-----TTIKSVSENI-------VVNPGEDAMLSCTVEGKPLTEEHVK---WERVGYDMTVK 816

  Fly   678 ------------ELQRAKR-NAGNWRALCEENGKRDN 701
                        .::.||| :.||:|  |..:.:.||
  Fly   817 TSTTFANGTSYLHIKDAKREDVGNFR--CVADNRVDN 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31773NP_722953.1 folC 309..745 CDD:273659 99/502 (20%)
snsNP_001036532.1 I-set 73..170 CDD:254352 14/78 (18%)
Ig 76..155 CDD:299845 12/63 (19%)
IG_like 186..279 CDD:214653 11/92 (12%)
Ig 197..279 CDD:299845 10/81 (12%)
IG_like 296..376 CDD:214653 15/90 (17%)
Ig 300..361 CDD:299845 12/71 (17%)
Ig 380..454 CDD:299845 18/97 (19%)
IG_like 490..573 CDD:214653 20/87 (23%)
Ig 501..560 CDD:299845 13/63 (21%)
Ig 584..666 CDD:299845 17/111 (15%)
IG_like 585..666 CDD:214653 17/110 (15%)
I-set 678..767 CDD:254352 20/107 (19%)
IGc2 692..757 CDD:197706 14/83 (17%)
Ig 788..849 CDD:143165 15/65 (23%)
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.