DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31773 and side-VI

DIOPT Version :9

Sequence 1:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001036705.1 Gene:side-VI / 4379854 FlyBaseID:FBgn0083950 Length:1087 Species:Drosophila melanogaster


Alignment Length:293 Identity:55/293 - (18%)
Similarity:85/293 - (29%) Gaps:91/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ANKPTQP-----------QSQPSQSQSSATQPTQ----------------P--PQQAEIKKNPLT 86
            |:|..||           |.|..|.|.....|.|                |  |..|.::::...
  Fly   813 ASKKGQPMGGVGVVQHVVQQQQQQQQGQVQHPHQLLGGTLPHGSSMRKLLPTIPATATLQRHKPN 877

  Fly    87 MGAI----SPAPPTPISPKPSVQPKIPDQRAKWMAKVSPESQRKAKLAAAGGSPPSGPPKNQFSQ 147
            .|.:    ..|||.........:|.|..|...:...........|.:.|..||..:|...:..|.
  Fly   878 AGGMQHPHQHAPPPTYDYDYFEEPTIYAQIDAYKTMQVDTGVVVAGVGAGAGSGVNGAGASISSP 942

  Fly   148 ANN--PSFAMPG-------QSSPANFSAAPKTQASWQQKVEKSAENEDSGAFKGASSESQRKNWM 203
            .::  ||...||       ...|..:...|....:.||                           
  Fly   943 GSHGTPSTVSPGTVQMYTLPQHPGGYHTLPHNHHAQQQ--------------------------- 980

  Fly   204 NRMQGSQQRKQNQWLKEMQAKQQAGKDIQAQKMQKMESQKATTTPAAPPKEAAPSTPQPAEKPEE 268
              |.|..|...:.    ||..||     |.|:.|:|....|:..|           |...:..::
  Fly   981 --MAGGPQNSASM----MQMMQQ-----QQQQQQQMHHHPASNMP-----------PSYQQHQQQ 1023

  Fly   269 KSPEHLAYLDAIKQLNSYQVLEPTSGRATTKSS 301
            :..:.:|:...:...||..:...|:..|:..||
  Fly  1024 QQQQQMAHGQMLVSSNSSGLASTTAAVASPSSS 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31773NP_722953.1 folC 309..745 CDD:273659
side-VINP_001036705.1 IG_like 35..140 CDD:214653
Ig_3 157..230 CDD:290638
IG_like 165..242 CDD:214653
Ig 265..343 CDD:299845
IG_like 267..343 CDD:214653
IG_like 363..440 CDD:214653
IGc2 364..429 CDD:197706
IG_like 456..532 CDD:214653
Ig_3 456..524 CDD:290638
fn3 545..622 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.