DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31773 and side-IV

DIOPT Version :9

Sequence 1:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster


Alignment Length:653 Identity:118/653 - (18%)
Similarity:203/653 - (31%) Gaps:270/653 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 PSTPQPAEKPEEKSPEHLAYLDAIKQLNSY-QVLEP---TSGRATTKSSRKEQDPVIEQTLECLE 317
            |:.|.|...|                 |.: |:|.|   .||.:...|:..|||.:: |.|:   
  Fly    30 PTAPHPFPSP-----------------NVWRQLLLPLLMLSGISQVCSTYVEQDELM-QNLD--- 73

  Fly   318 KSGLTKKDLKAIPVIQVAGSKGRGSTCAIVESILRCHGVKTGVLSSPH-----LFLTSERIRIDG 377
                     :.:|:..|.|..||       :::|.|.       .||.     :::.......||
  Fly    74 ---------RPVPLTTVQGVLGR-------QAMLPCD-------ISPQERDDAVYMVLWFREGDG 115

  Fly   378 EPL--SDV---QFTEL-FWKINTDLANMQPTPSYNKIMTVMAFHAFHQAGVEVAILEVGNAGA-- 434
            ||:  .||   ||.:. .|...|...    |.::....|       |.|.:::..:.:.:.|.  
  Fly   116 EPIYNFDVRGRQFGQARLWSSPTAFG----TRAHFSSTT-------HPAQLKIDNIRIEDEGVYR 169

  Fly   435 --SDATNIASHAQTIGITTL---------GWEQSSNLGNSLRDIAWAKASIMKPEANIYTNVTQT 488
              .|..|..:....|.:|.:         |..:....|| :...:.....::.            
  Fly   170 CRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEKAGN-VESFSEGNDIVLS------------ 221

  Fly   489 ECCEVLAQKAKQIGAQLRRVPTFNDYVEGDMNNKLLMNKANYSMRLNGSLAVQLAYDFLKRHKPE 553
              |||...:.:         |....|::....::      ::..|.:|.....|:|       |.
  Fly   222 --CEVSGGRPR---------PNVTWYLDNTAIDE------SFEQRPDGKTINHLSY-------PN 262

  Fly   554 YVVGLEH---------NSTLLTPGASRGI--EIFEQPGHFDFMRHDMFNVYLDSAD-TFESMMAC 606
              ||.:|         ::|.|||..:|.:  ::..:|.....:..|.|    .||| |::  :.|
  Fly   263 --VGRQHLNSRLMCVASNTNLTPPNNRVVILDVNLKPIAVHILTKDRF----VSADRTYD--VEC 319

  Fly   607 RD----------WFYTRTRANRQPKILLFNKVNEFNAKD-----LLTI------------IRSNL 644
            :.          |:    :.::|.|.|..|    ||..|     :||.            .|:..
  Fly   320 KSSGSKPPALITWW----KGSKQLKKLTKN----FNEPDNQSLSILTFTPGREDDGKYLTCRAEN 376

  Fly   645 RFEEACFVP---------------------NPN--------YFEGEILAEEDGKAMVW-HGMEEL 679
            :|.:...:.                     ||:        |||..:||......|.| |..:||
  Fly   377 QFIDGSAIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKEL 441

  Fly   680 QR------------------AKRNAGNWRALC-EENGKRDNSQLSISIN---------------- 709
            |.                  ::.:||::..|. ...||..::.:::.|.                
  Fly   442 QHNISAGVILSDQSLVLQSVSRASAGDYTCLAVNSEGKGPSNPVTLRIRYAPICATDHEELLGAL 506

  Fly   710 -----------------AFFEYLTNKYGKQ----------KYGMKNELDVLVTGSRQLVAATISC 747
                             ..|::..|..|:|          :.||..   :..|.|..|...||||
  Fly   507 KHETLPLKCEVDSSPPADSFQWTFNSSGEQTELPARLHSSETGMSR---LNYTPSTDLDYGTISC 568

  Fly   748 LRK 750
            ..|
  Fly   569 WAK 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31773NP_722953.1 folC 309..745 CDD:273659 99/590 (17%)
side-IVNP_001034052.2 V-set 79..188 CDD:284989 26/133 (20%)
IG_like 80..188 CDD:214653 26/132 (20%)
Ig 210..281 CDD:299845 14/108 (13%)
Ig 319..392 CDD:299845 13/80 (16%)
IG_like 319..383 CDD:214653 13/71 (18%)
IG_like 412..489 CDD:214653 16/76 (21%)
IGc2 413..478 CDD:197706 14/64 (22%)
Ig_3 509..572 CDD:290638 14/66 (21%)
fn3 593..675 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.