DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31773 and ed

DIOPT Version :9

Sequence 1:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster


Alignment Length:782 Identity:131/782 - (16%)
Similarity:229/782 - (29%) Gaps:313/782 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AEIKKNPLTMGAISPAPPTPISPKPSVQPKIPDQRAKWMAKVSPESQRKAKLAAAGGSPPSGPPK 142
            |::.:....:..::|..|..|||..             :|..:.:...:...::.||||  .|..
  Fly   135 ADVHQEFHNLTVLTPPHPPVISPGN-------------IAVATEDKPMELTCSSIGGSP--DPTI 184

  Fly   143 NQFSQANN---PSFAMPG----QSSPANFSAAPKTQASWQQKVEKSAENEDSGAFKGASSESQRK 200
            ..:.:.:|   |:..:.|    |.:.|..|..|:              .||.||.......::..
  Fly   185 TWYREGSNTPLPATVLKGGTKDQPTNATLSIIPR--------------REDDGAKYKCVVRNRAM 235

  Fly   201 NWMNRMQGSQQRKQNQWLKEMQAKQQAGKDIQAQKMQKMESQKATTTPAAPPKEAAPSTPQPAEK 265
            |...|::.:.....|.:                                 |..|..|..|...|:
  Fly   236 NEGKRLEATATLNVNYY---------------------------------PRVEVGPENPLRVER 267

  Fly   266 PEEKSPEHLAYLDAIKQLNSYQ----------VLEPTSGRATTKSSRKEQDPVIEQTLECLEKSG 320
              :::.:....:||..::.:.:          .|..|..|.:.:.:.|         ..|:..:|
  Fly   268 --DRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGK---------YTCIADNG 321

  Fly   321 LTKKDLKAI------PVIQVAGSKGR----GSTCAIVESILRCHGVKTGVLSSPHLFLTSERIRI 375
            |.|...:.:      |.:.|..||.|    |.|..|     ||:     |.::|           
  Fly   322 LGKTGEQELILDILYPPMVVIESKTREAEEGDTVTI-----RCN-----VTANP----------- 365

  Fly   376 DGEPLSDVQFTELFWKINTDLANMQPTPSYN-KIMTVMAFHAFHQAGVEVAILEVGNAGASDATN 439
              .|::      :.|     |....|...|| .::|:.:..|.|                  |.|
  Fly   366 --APVT------IEW-----LKENSPDFRYNGDVLTLTSVRADH------------------AGN 399

  Fly   440 IASHAQTIGITTLGWEQSSNLGNSLRDI------AWAKASIMKPEANIYTNVTQTECC------- 491
            ....|..| :.:.|.|:|..:|||...:      ..|..:..||..::...||.| |.       
  Fly   400 YICRAVNI-MQSQGMERSERVGNSTVALLVRHRPGQAYITPNKPVVHVGNGVTLT-CSANPPGWP 462

  Fly   492 ------------------EVLAQ-------KA-------------KQIG--------AQLRRVPT 510
                              ::|||       ||             .::|        .::.:.|.
  Fly   463 VPQYRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEGKYHCHAVNELGIGMMATIVLEIHQPPQ 527

  Fly   511 F----------------------------------NDYVEGDMNNKLLMNKANYSMRLNGSLAVQ 541
            |                                  .|.||......|...:.|....|||.:.||
  Fly   528 FLAKLQQHMTRRVADTDYTVTCSAKGKPAPSVKWLKDAVEILPEENLYEVQTNPDQGLNGMVTVQ 592

  Fly   542 LAYDFLKRHKPEYVVGLEHNSTLLTPGASRGIEIFEQPGHFDFMRHDMFNVYLDSADTFESMMAC 606
            ....|..:.:|        |...|.|| .||:...               :|.:..::..|.|  
  Fly   593 SQLKFRGKARP--------NGNALVPG-DRGLYTC---------------LYQNEVNSANSSM-- 631

  Fly   607 RDWFYTRTRANRQPKIL-LFNKVNEFNAKDLLTIIRSNLRFEEACFV---PNPNYFEGEILAEED 667
                  :.|...:|.:| .:||| .|:.::...::         |.|   |.|.:          
  Fly   632 ------QLRIEHEPIVLHQYNKV-AFDIRETAEVV---------CKVQAYPKPEF---------- 670

  Fly   668 GKAMVWH-GMEELQRAKRNAGNWRALCEENGKRDNSQLSISINAFFEYLTNKYGKQKYGMKNELD 731
                .|. |.........:.|::    |.:...||:.:..|:........:.||:....:.|.||
  Fly   671 ----QWQFGNNPSPLTMSSDGHY----EISTTTDNNDIYTSVLKINSLTHSDYGEYTCRVANTLD 727

  Fly   732 VL 733
            .:
  Fly   728 TI 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31773NP_722953.1 folC 309..745 CDD:273659 94/534 (18%)
edNP_001260013.1 Ig 50..147 CDD:299845 1/11 (9%)
I-set 146..249 CDD:254352 24/131 (18%)
Ig 168..249 CDD:299845 18/96 (19%)
IGc2 268..323 CDD:197706 8/63 (13%)
Ig_3 341..406 CDD:290638 23/116 (20%)
Ig_2 437..514 CDD:290606 12/77 (16%)
I-set 526..633 CDD:254352 23/138 (17%)
Ig 546..632 CDD:143165 21/117 (18%)
IG_like 654..736 CDD:214653 16/103 (16%)
Ig 656..734 CDD:143165 16/101 (16%)
FN3 741..848 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.