DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31773 and igcm-1

DIOPT Version :9

Sequence 1:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_508166.1 Gene:igcm-1 / 180433 WormBaseID:WBGene00018215 Length:1073 Species:Caenorhabditis elegans


Alignment Length:287 Identity:57/287 - (19%)
Similarity:101/287 - (35%) Gaps:79/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 SAAPKTQASWQQKVEKSAENE-DSGAFKGASSESQRKNWMNRMQGSQQRKQNQWLKEMQAKQQAG 228
            ||.|:.:..|..:..:.:||| .|....|.:.:......:.:::..|:....:::  .:|....|
 Worm   657 SARPEPEFHWMFRDSEISENERHSFHTVGITGKPDEYEQLLQIESVQESDYGEYV--CRATNGNG 719

  Fly   229 KDIQAQKMQKMESQKATTTPAAPPKEAAPSTPQPAEKPEEKS--------PEHLAYLDAIKQLNS 285
            .|....:::|       |:|        |:.|...:|....|        |:.....|....|.:
 Worm   720 GDHVVIELRK-------TSP--------PALPLDLQKLSATSNSVLLGWVPQFDGGADQTYVLET 769

  Fly   286 YQVLEPTSGR-------ATTKSSRKEQDPVIEQTL---ECLEKSGLTKKDLKAIPV------IQV 334
            .:: :|.:|.       :....:..:||..|:.||   .....:|||       |:      ||.
 Worm   770 RKI-DPFTGEIDGNAPVSKLNINAVQQDQEIDGTLVSKNIFNFTGLT-------PLSTYNLRIQA 826

  Fly   335 AGSKGR--------GSTCAIVESILRCHGVKTGVLSSPHLFLTSERIRIDGEPL--SDV-----Q 384
            ...||.        .||..:||.        ..::|...|.|.|...:|:.||.  ||.     .
 Worm   827 VSEKGESEFTPVLIASTEDVVED--------ANMMSPSRLVLDSSEQKINVEPKLPSDACTLLYV 883

  Fly   385 FTELFWKINT------DLANMQPTPSY 405
            |.:..|:.:|      .:.|:.|...|
 Worm   884 FLDGIWRTSTCHTSSNPIGNIIPGREY 910

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31773NP_722953.1 folC 309..745 CDD:273659 30/127 (24%)
igcm-1NP_508166.1 Ig 45..119 CDD:299845
Ig 146..226 CDD:299845
Ig_3 245..316 CDD:290638
IG_like 258..329 CDD:214653
IG_like 338..398 CDD:214653
IGc2 347..398 CDD:197706
Ig_2 429..513 CDD:290606
IG_like 437..513 CDD:214653
Ig 537..615 CDD:143165
IG_like 644..728 CDD:214653 13/72 (18%)
IGc2 646..719 CDD:197706 11/63 (17%)
FN3 733..843 CDD:238020 22/117 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.