DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and NGL1

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_014600.1 Gene:NGL1 / 854115 SGDID:S000005402 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:366 Identity:90/366 - (24%)
Similarity:157/366 - (42%) Gaps:77/366 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 VVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRKPLFINEIIG-YNSDILCLQEVDQRIFD-- 300
            :::||:|     |..|....:::|....|....||..|...|::. :.:||:||||:..|.::  
Yeast    29 LLTYNML-----SPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYEDY 88

  Fly   301 ----------FDLKEILEQPPYNYHGIMAPKGKCAEGVAIFFRNSRFDLLDSQILHLGSNIPALP 355
                      :..|.|.:.||..:...:    |..:||:||:..::||.:.|..::|..   .|.
Yeast    89 WHDSIGVDVNYGSKFISKTPPKYWKKPV----KDMDGVSIFYNLAKFDFISSSGIYLNQ---LLN 146

  Fly   356 VFES-----LWNKIKVNAQLAERICERSTTL-------QTCL---LRIKGTDNYVLVANTHLYFH 405
            ||..     |:||.......|..:....:.|       |.||   ||.|.|....:|.|||||: 
Yeast   147 VFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFVVLNTHLYW- 210

  Fly   406 PDADHIRLLQMGFSMLFVEQSISKAIKDF---NISSHKNIGLIFCGDFNSVPECGIYKLMTEQLA 467
             ..|.::|.|    .:.:.:.:||.||..   ::...:.:.::|.||.||..:..:...:..|: 
Yeast   211 -KYDEVKLTQ----CMIIMRELSKIIKQLLPGDVKGQERVKILFTGDLNSTRDSLVVNFLQGQI- 269

  Fly   468 EKTLEDWQSNAEQAVSNVEL-----AQPFKMASAY-GAPE----YTHYTTLFAGCLDYVFYQNDR 522
                          ||:.:|     .:|:.....| ..|:    :|.|:....|..|||:|.:..
Yeast   270 --------------VSHGDLNLINPMRPYLDRCVYDDIPKDYFVHTCYSGKLKGIFDYVWYHDSD 320

  Fly   523 FEVLKVVP-LPTEEELKANT--AIPSAVFPSDHVALVADLK 560
            |.:.|::. ....:||.|:.  .:|:...||||:.|:.:.|
Yeast   321 FLLTKILTGNEVSDELLASNQLGLPNENHPSDHIPLLTEFK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 90/366 (25%)
NGL1NP_014600.1 CCR4 1..363 CDD:227564 90/366 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.