DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and AT1G31500

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001323328.1 Gene:AT1G31500 / 840040 AraportID:AT1G31500 Length:422 Species:Arabidopsis thaliana


Alignment Length:374 Identity:89/374 - (23%)
Similarity:162/374 - (43%) Gaps:74/374 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LSESNE--------IRVVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRKPLFINEIIGYNSD 287
            :..|||        .|:||||:||.:|..     |.|..:.|...|:...|....::.:....:|
plant    83 IGTSNENFVFSGIRFRLVSYNILAQVYVK-----SALLPHSPPACLKWKARSHAILSVLKNLQAD 142

  Fly   288 ILCLQEVDQRIFDFDLKEILEQPPYNYHGIMAPKGKCAEGVAIFFRNSRFDLLDSQILHLGSNIP 352
            ..||||||:  :|...:..::...|:...|.....:..:|.|||::.|..:|:..:.:.      
plant   143 FFCLQEVDE--YDSFYRNNMDSLGYSGIYIQRTGQRKRDGCAIFYKPSCAELVTKERIE------ 199

  Fly   353 ALPVFESLWNKIKVNA-QLAERICERST----------TLQTCLLRIKGT--------------D 392
                :..|.:.||.:: ..:|:..|.|.          .|...|:|:|..              .
plant   200 ----YNDLVDSIKADSVSCSEQKIETSNEGKDSRKDSRDLNDPLVRLKRDCVGIMAAFRINKPFQ 260

  Fly   393 NYVLVANTHLYFHPDADHIRLLQMGFSMLFVEQSISKAIKDFNISSHKNIGLIFCGDFNSVPECG 457
            :.|:|||||||:.|:...::|.|..:.:..:.|..:....:|..:.    .|:..|||||:|...
plant   261 HIVIVANTHLYWDPELADVKLAQAKYLLSRLAQFKTLISDEFECTP----SLLLAGDFNSIPGDM 321

  Fly   458 IYKLMTEQLAE--KTLEDWQSNAEQAVSNVELAQPFKMASAY----GAPEYTHYTTLFAGCLDYV 516
            :|..:....|:  :|:|:     |:|        |..::|.|    |.|::|:.|..|...|||:
plant   322 VYSYLVSGNAKPTETIEE-----EEA--------PVPLSSVYEVTRGEPKFTNCTPGFTNTLDYI 373

  Fly   517 FYQ-NDRFEVLKVVPLPTEEELKANTAIPSAVFPSDHVALVADLKFKSD 564
            |.. :|..:.:.::.||..:.......:|:...||||:.:.|:.:.:.:
plant   374 FISPSDFIKPVSILQLPEPDSPDVVGFLPNHHHPSDHLPIGAEFEIRRE 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 85/353 (24%)
AT1G31500NP_001323328.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.