DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and LRRC27

DIOPT Version :10

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_085129.1 Gene:LRRC27 / 80313 HGNCID:29346 Length:530 Species:Homo sapiens


Alignment Length:234 Identity:48/234 - (20%)
Similarity:71/234 - (30%) Gaps:96/234 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 GVAIFFRNSRFDLLDS--------------QILHLGSN------------IPALPVFESLWNKIK 365
            |..||..:...||.:|              |.|||..|            :|.|...:..:|:||
Human    40 GGIIFSSSPILDLSESGLCRLEEVFRIPSLQQLHLQRNALCVIPQDFFQLLPNLTWLDLRYNRIK 104

  Fly   366 -------VNAQLAERICERS------------TTLQTCLLRIKGTDNYVLVANTHLYFHPDADHI 411
                   .:..|...:.||:            |||:...||           :..|.|.|..   
Human   105 ALPSGIGAHQHLKTLLLERNPIKMLPVELGSVTTLKALNLR-----------HCPLEFPPQL--- 155

  Fly   412 RLLQMG-------FSMLFVEQSISK--------AIKDFNISSHKNIGLIFCGDFNS--------V 453
             ::|.|       ..|..||.|:.:        .:::..:....:.||...||..|        .
Human   156 -VVQKGLVAIQRFLRMWAVEHSLPRNPTSQEAPPVREMTLRDLPSPGLELSGDHASNQGAVNAQD 219

  Fly   454 PECGIYKLMTEQL--AEK-----------TLEDWQSNAE 479
            ||..:.|.....|  .||           :.|:|.|..|
Human   220 PEGAVMKEKASFLPPVEKPDLSELRKSADSSENWPSEEE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:469791 48/234 (21%)
LRRC27NP_085129.1 LRR 1 46..67 3/20 (15%)
LRR <49..>155 CDD:443914 24/116 (21%)
leucine-rich repeat 49..68 CDD:275378 3/18 (17%)
LRR 2 68..89 5/20 (25%)
leucine-rich repeat 69..92 CDD:275378 5/22 (23%)
LRR 3 92..113 4/20 (20%)
leucine-rich repeat 93..115 CDD:275378 4/21 (19%)
LRR 4 115..136 3/20 (15%)
leucine-rich repeat 116..138 CDD:275378 3/21 (14%)
LRR 5 138..159 7/35 (20%)
leucine-rich repeat 139..150 CDD:275378 3/21 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..215 5/36 (14%)
PTZ00121 <225..496 CDD:173412 8/34 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..432
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.