DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and CNOT6

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001357401.1 Gene:CNOT6 / 57472 HGNCID:14099 Length:557 Species:Homo sapiens


Alignment Length:462 Identity:125/462 - (27%)
Similarity:206/462 - (44%) Gaps:111/462 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VTPEDIG--YHLKFVVTPGNALGMTG-PVVEKITNSAVQESPGRCPFQD---------RQRHTTN 229
            |.|.::|  :.|:       .||:.| |:.:.|.| ..||..|.....:         .:|.||.
Human   111 VLPFELGKLFQLQ-------TLGLKGNPLTQDILN-LYQEPDGTRRLLNYLLDNLSGTAKRITTE 167

  Fly   230 S--------LSESNEIR------VVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRKPLFINE 280
            .        |.|.:..|      |:.||:|.|.||:..     |:.|||:..|..||||...|.|
Human   168 QPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQ-----LYGYCPSWALNWDYRKKAIIQE 227

  Fly   281 IIGYNSDILCLQEVD-QRIFDFDLKEILEQPPYNYHGIMAPKG----------KCAEGVAIFFRN 334
            |:..|:||:.||||: ::.:.|.|.|:.|:   .|:|..:||.          |..:|.||||:.
Human   228 ILSCNADIVSLQEVETEQYYSFFLVELKER---GYNGFFSPKSRARTMSEQERKHVDGCAIFFKT 289

  Fly   335 SRFDLLDSQILHLGSNIPALPVFESLWNKIKV-NAQLAERICERSTTLQ----TCLLRIK----- 389
            .:|.|:....:.              :|::.: |::.:|.:..|..|..    ..||.::     
Human   290 EKFTLVQKHTVE--------------FNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIE 340

  Fly   390 --------GTD-NYVLVANTHLYFHPDADHIRLLQMGFSMLF---VEQSISKA---IKDFNISSH 439
                    ||: ..:||||.|:::.|:...::|:|   :|:|   |:..|.||   :|...:...
Human   341 MPSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQ---TMMFLSEVKNIIDKASRNLKSSVLGEF 402

  Fly   440 KNIGLIFCGDFNSVPECGI------------YKLMTEQLAEKTLEDWQSNAEQAVSNVELAQPFK 492
            ..|.|:.|.|.||:|:.|:            :|...|....::|.::..:.:...:|..:...||
Human   403 GTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFK 467

  Fly   493 MASAY--GAPEYTHYTTLFAGCLDYVFYQNDRFEVLKVV-PLPTEEELKAN-TAIPSAVFPSDHV 553
            :.|||  |...||:||..|.|.:||:||...:...|.:: ||.....::.| :..|..:.||||.
Human   468 LQSAYESGLMPYTNYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHF 532

  Fly   554 ALVADLK 560
            :|.|.|:
Human   533 SLFAQLE 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 106/374 (28%)
CNOT6NP_001357401.1 leucine-rich repeat 33..52 CDD:275378
LRR <52..>159 CDD:227223 13/55 (24%)
LRR 1 52..73
leucine-rich repeat 53..75 CDD:275378
LRR 2 75..96
leucine-rich repeat 76..98 CDD:275378
LRR 3 98..120 3/8 (38%)
leucine-rich repeat 99..121 CDD:275378 3/9 (33%)
LRR 4 121..143 8/29 (28%)
leucine-rich repeat 122..133 CDD:275378 5/17 (29%)
Nuclease domain. /evidence=ECO:0000250 153..557 112/412 (27%)
Deadenylase_CCR4a 191..540 CDD:197340 106/374 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.