DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and cnot6l

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001018474.1 Gene:cnot6l / 553665 ZFINID:ZDB-GENE-050522-302 Length:559 Species:Danio rerio


Alignment Length:453 Identity:118/453 - (26%)
Similarity:203/453 - (44%) Gaps:98/453 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VTPEDIG--YHLKFVVTPGNALGMTG-PVVEKITNSAVQESPGR-------------CPFQDRQR 225
            |.|.::|  :.|:       .||:.| |:.:.|.| ..||..|.             .|.|..||
Zfish   111 VLPYELGRLFQLQ-------TLGLKGNPLSQDILN-LYQEPDGTRKLLNYMLDNLAVHPEQLPQR 167

  Fly   226 HTTNSLSESNEI------RVVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRKPLFINEIIGY 284
            ... :|.|.:::      .|:.||:|.|.||:..     |:.|||:..|..:|||...:.||...
Zfish   168 PWI-TLRERDQMMPTAVFTVMCYNVLCDKYATRQ-----LYGYCPSWALNWEYRKKGIMEEITNC 226

  Fly   285 NSDILCLQEVD-QRIFDFDLKEILEQPPYNYHGIMAPKG----------KCAEGVAIFFRNSRFD 338
            ::||:.||||: ::.:.|.|:.:.::   .|.|...||.          |..:|..:||:..:|.
Zfish   227 DADIISLQEVETEQYYTFFLETLKDR---GYDGFFCPKSRAKLVSEQERKHVDGCGVFFKTEKFA 288

  Fly   339 LLDSQILHLGSNIPALPVFESLWNKIKVNAQLAERICERSTTLQTCLLRIK-----------GTD 392
            |:....:....    :.:..|..:::.:|     |:..:.......||.:|           ...
Zfish   289 LVQKHTVEFNQ----VAMANSEGSEVMLN-----RVMTKDNIGVAVLLEVKEDLFAAGLKPPPEK 344

  Fly   393 NYVLVANTHLYFHPDADHIRLLQMGFSMLFVEQ--SIS-KAIKDFNISS----HKNIGLIFCGDF 450
            ..:||||.|:::.|:...::|:|   :|:|:.:  ||: :|....|.||    ..:|.::.|.|.
Zfish   345 QLLLVANAHMHWDPEYSDVKLIQ---TMMFLSELKSIAERASGSINSSSPTSETSSIPIVLCADL 406

  Fly   451 NSVPECGIYKLMTE-QLAEK-----------TLEDWQSNAEQAVSNVELAQPFKMASAY--GAPE 501
            ||:|:.|:.:.::. .:||.           .|.::..|.:....:..:...|::.|||  ....
Zfish   407 NSLPDSGVVEYLSNGGVAENHKDFKELRYSDCLTNFSCNGKNGKPDGSITHSFQLKSAYEGNLMP 471

  Fly   502 YTHYTTLFAGCLDYVFYQNDRFEVLKVV-PLPTEEELKAN--TAIPSAVFPSDHVALVADLKF 561
            ||:||..|.|.:||:|:......||.|: ||.| :.||.|  |..|....||||.:|:|.|::
Zfish   472 YTNYTYDFKGVIDYIFFSKTHMSVLGVLGPLET-QWLKDNNITGCPHPHIPSDHFSLLAQLEY 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 99/367 (27%)
cnot6lNP_001018474.1 Nuclease domain. /evidence=ECO:0000250 1..550 118/453 (26%)
Required for interaction with cnot1, cnot3 and cnot7. /evidence=ECO:0000250 1..148 13/44 (30%)
leucine-rich repeat 32..52 CDD:275378
LRR_8 51..107 CDD:290566
LRR_4 51..91 CDD:289563
leucine-rich repeat 53..75 CDD:275378
leucine-rich repeat 76..98 CDD:275378
leucine-rich repeat 99..121 CDD:275378 3/9 (33%)
leucine-rich repeat 122..133 CDD:275378 5/17 (29%)
Deadenylase_CCR4b 186..533 CDD:197339 99/367 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.