DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and noct

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001016531.1 Gene:noct / 549285 XenbaseID:XB-GENE-1014542 Length:458 Species:Xenopus tropicalis


Alignment Length:369 Identity:112/369 - (30%)
Similarity:160/369 - (43%) Gaps:73/369 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 AVQESPGRCPFQDRQRHTTNSLSESNEIRVVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRK 274
            |:|:.|.|. .:|......:|.|:....||:.:|:||.....    |...|..||.:.|:.:.||
 Frog   144 ALQDRPARL-HRDLVSLRNDSGSQPRSFRVMQWNILAQALGE----GKDNFIMCPMEALKWEERK 203

  Fly   275 PLFINEIIGYNSDILCLQEVDQRIFDFDLKEILEQPPYNYHGIMAPKGKC--------AEGVAIF 331
            .|.:.||:.|..|:||||||| ..|| ..:.||.:..|....:..|...|        .:|.|:|
 Frog   204 YLILEEILMYQPDVLCLQEVD-HYFD-TFQPILSRLGYQCTFLAKPWSPCLDVEHNNGPDGCALF 266

  Fly   332 FRNSRFDLLDSQILHLGSNIPALPVFESLWNKIKVNAQLAERICERSTTLQTCLLRIKGTDNYVL 396
            |...||.|::|..:.|.:            ..:|.| |:|  |.|   |||.|     .|...:.
 Frog   267 FLQDRFRLVNSAKIRLSA------------RTLKTN-QVA--IAE---TLQCC-----ETGRLLC 308

  Fly   397 VANTHLYFHPDADHIRLLQMGFSMLFVEQSISKAIKDFNISSHKNIGLIFCGDFNSVPECGIYKL 461
            .|.|||......:..||.| |..:|...:||::.         ..:.||.|||||:.|...:||.
 Frog   309 FAVTHLKARTGWERFRLAQ-GSDLLHNLESITEG---------ATVPLIICGDFNAEPTEEVYKR 363

  Fly   462 MTEQLAEKTLEDWQSNAEQAVSNVELAQPFKMASAYG--APEYTHYTTLFAG--C--LDYVFYQN 520
            .                  |.|::.|...:|:.|..|  .|.||.:.....|  |  |||::|..
 Frog   364 F------------------ASSSLNLNSAYKLLSEDGESEPPYTTWKIRPTGESCHTLDYIWYSQ 410

  Fly   521 DRFEVLKVVPLPTEEELKANTAIPSAVFPSDHVALVADLKFKSD 564
            ....|...:.|||||::..| .:||..:||||::||.|..|..|
 Frog   411 HALRVNSALGLPTEEQIGPN-RLPSFNYPSDHLSLVCDFSFNED 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 102/335 (30%)
noctNP_001016531.1 Deadenylase_nocturnin 171..450 CDD:197330 103/336 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1970
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.