DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and Lrrc27

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001137228.1 Gene:Lrrc27 / 499281 RGDID:1559981 Length:513 Species:Rattus norvegicus


Alignment Length:318 Identity:63/318 - (19%)
Similarity:104/318 - (32%) Gaps:88/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KKSKIKPPAEINVKLLSDKYGEKFNELTFEDLVVTQ----DISNVKLQVLD-------------- 108
            |.:|....|....|.|.|.:....:::.||.::.:.    |:|...|:.|.              
  Rat    12 KAAKDPKDAAATAKSLPDSFSRDNDQVDFEGVIYSSSPILDLSQKGLRHLGKFFKIPNLQQLHLQ 76

  Fly   109 ------------------TVYDLVFN-----PPWISSLKFLPSCILAGFVIYPTNVQIQFGERQF 150
                              |..||.:|     ||.|.|.|.|.:.:|               ||..
  Rat    77 RNLLSEIPQDFFQLLPNLTWLDLRYNKIRVLPPGIGSHKHLKTLLL---------------ERNP 126

  Fly   151 SKAVWFKAKKPTD---TDWEVCGEGF-QYLVTPEDIGYHLKF--VVTPGNALGMTGPVVEKITNS 209
            .||:..:..:.|.   .:...|...| .||:..:.:...|.|  :.:..||.    |..|.:...
  Rat   127 IKALPVELGQVTTLTALNLRHCPLEFPPYLIVQKGLVSILTFLRICSVENAF----PGDESLPGV 187

  Fly   210 AVQESPGRCPFQDRQRHTTNSLSESNEIRVVSYNLLADLYASSDYAGSTLFSYCPAKYLQI-DYR 273
            ...:|....|...:      .||..|.:.|:... .|.:....|:       :.|...|.: :.|
  Rat   188 PTAKSDLLLPLPHK------DLSSENGLNVLDQE-AAVVKEKGDF-------FPPMDRLDLSELR 238

  Fly   274 KPLFINEIIGYNSDILCLQEVDQRIFDFDLKEI-------LEQPPYNYHGIMAPKGKC 324
            |....:||.....:|....::.|.|.:.:..|:       :|.||.....|.|.:.||
  Rat   239 KSSSSSEIWPSKEEIRRFWKLRQEIVENEQVEVQENKLLAVELPPNLKAAINAKERKC 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 20/94 (21%)
Lrrc27NP_001137228.1 PLN00113 30..>173 CDD:215061 28/157 (18%)
leucine-rich repeat 50..69 CDD:275378 4/18 (22%)
LRR_8 68..127 CDD:404697 13/73 (18%)
leucine-rich repeat 70..93 CDD:275378 0/22 (0%)
leucine-rich repeat 94..116 CDD:275378 8/21 (38%)
leucine-rich repeat 117..139 CDD:275378 6/36 (17%)
leucine-rich repeat 140..151 CDD:275378 1/10 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.