DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and cu

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster


Alignment Length:363 Identity:103/363 - (28%)
Similarity:154/363 - (42%) Gaps:81/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 NSLS-------ESNEIRVVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRKPLFINEIIGYNS 286
            ||:|       |.::||::.:|:|:......:..    |..||.:.|..::||.|.:.||:....
  Fly   296 NSVSRVCSAPVEGDDIRLLQWNILSQTLGQHNDG----FVRCPEEALTWEHRKYLIVQEILQNQP 356

  Fly   287 DILCLQEVDQRIFDFDLKEILEQPPYNYHGIMAPK--GKC--------AEGVAIFFRNSRFDL-- 339
            |::||||||.  |.| |:.:|..  .||.||..||  ..|        .:|.|||::..:..|  
  Fly   357 DVICLQEVDH--FKF-LQTVLGS--QNYAGIFFPKPDSPCLYIEQNNGPDGCAIFYKRDKLQLQG 416

  Fly   340 LDSQILHLGSNIPALPVFESLWNKIKVNAQLAERICERSTTLQTCLLRIKGTDNYVLVANTHLYF 404
            .|::||             .:|........:|.|:..||:..:.|            ||.|||  
  Fly   417 YDTRIL-------------EVWRVQSNQVAIAARLRMRSSGREFC------------VATTHL-- 454

  Fly   405 HPDADHIRLLQMGFSMLFVEQ--SISKAIKDFNISSHKNIGLIFCGDFNSVPECGIYKLMTEQLA 467
              .|.|..||    :.|..||  .:.:.:|.|    ..:..|:.|||||:.|...||..:   |.
  Fly   455 --KARHGALL----AKLRNEQGRDLIRFVKQF----AGDTPLLLCGDFNAEPVEPIYATI---LG 506

  Fly   468 EKTLEDWQSNAEQAVSNVELAQP------FKMASAYGAPEYTHYTTLFAG--C--LDYVFYQNDR 522
            ...|....:.|:..:...|:..|      |...|....|.||.:.....|  |  :|||||..||
  Fly   507 CDLLRLGSAYADVKLDREEILHPNADVGEFVAKSMKREPPYTTWKIREEGEECHTIDYVFYTPDR 571

  Fly   523 FEVLKVVPLPTEEELKANTAIPSAVFPSDHVALVADLK 560
            .::...:..|..|::..|.. ||..:||||.:||.|.:
  Fly   572 LKIKNCLDFPAGEQIGKNRT-PSFQYPSDHFSLVCDFE 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 97/346 (28%)
cuNP_001097746.1 EEP 312..609 CDD:382041 98/347 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443964
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12121
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1970
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.