DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and angel

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster


Alignment Length:407 Identity:92/407 - (22%)
Similarity:150/407 - (36%) Gaps:111/407 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 ALGMTGPVVEKITNSAVQESPGRC--------PFQDRQRHTTNSLSESNE---------IRVVSY 242
            :|..|..::.:..:|..:.:.|:.        ...||.|..| ||....|         .:||||
  Fly    10 SLKATSRIIRRSVSSQAKGASGKRKQKAKEMESSHDRNRRWT-SLGNQAEGRDPHKCSSFKVVSY 73

  Fly   243 NLLADLYASSDYAGSTLFSY--CPAKYLQIDYRKPLFINEIIGYNSDILCLQEVDQRIFDFDLKE 305
            |:||     .|.....||.|  .|.::|....|:...:.|::..:.|||||||:     .||...
  Fly    74 NILA-----QDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEM-----QFDHLP 128

  Fly   306 ILEQPPYNYHG-----IMAPKGKC-AEGVAIFFRNSRFDLLDSQILHLGSNIPALPVFE--SLWN 362
            :|.|.....:|     :...|..| .:|.||.:.:|:|:|||.|.:.|.....||...:  :|:.
  Fly   129 VLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFA 193

  Fly   363 KIKVNAQLAERICERSTTLQTCLLRIKGTDNYVLVANTHLYFHPDADHIRLLQMGFSMLFVEQSI 427
            :.:...|..::                   ...:||.|||.|:.....:|..|:        :.|
  Fly   194 RFRFKKQQEQQ-------------------KEFVVATTHLLFNTKRSDVRCAQV--------ERI 231

  Fly   428 SKAIKDFNISSHKNIGLIFCGDFNSVPECGIYKLMTEQLAEKTLEDWQSNAEQAVSNVELAQPFK 492
            .:.::.|:..:    .::..|||||:|:....:.:..:..     |..|.|              
  Fly   232 LEELQSFSTDT----PIVLTGDFNSLPDSSPIEFLVGKNG-----DVDSTA-------------- 273

  Fly   493 MASAYGAPEYTHYTTLFAGCLDYVFYQND-----------------RFEVLKVVPLPTEEELKAN 540
                  .||..|:..:.:|......|||:                 :...|.|..||:.......
  Fly   274 ------CPEPLHFEIIDSGEGTASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYSLPSINRCIGA 332

  Fly   541 TAIPSAVFPSDHVALVA 557
            ..||:....|||.||.|
  Fly   333 GQIPNYRLGSDHYALGA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 81/346 (23%)
angelNP_477204.1 EEP 70..351 CDD:294334 81/346 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12121
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.