DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and Cnot6l

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_006250770.1 Gene:Cnot6l / 360917 RGDID:1309128 Length:555 Species:Rattus norvegicus


Alignment Length:463 Identity:119/463 - (25%)
Similarity:198/463 - (42%) Gaps:115/463 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 YL-VTPEDIG--YHLKFVVTPGNALGMTGPVVEKITNSAVQESPGRCPFQDRQRHTTN------- 229
            || |.|.::|  :.|:       .||:||..:.:...|..|:..|       .|...|       
  Rat   113 YLRVLPYELGRLFQLQ-------TLGLTGNPLSQDIMSLYQDPDG-------TRKLLNFMLDNLA 163

  Fly   230 ------------SLSESNEI------RVVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRKPL 276
                        :|.|.::|      .|:.||:|.|.||:..     |:.|||:..|..:|||..
  Rat   164 VHPEQLPPRPWITLKERDQILPSASFTVMCYNVLCDKYATRQ-----LYGYCPSWALNWEYRKKG 223

  Fly   277 FINEIIGYNSDILCLQEVD-QRIFDFDLKEILEQPPYNYHGIMAPKG----------KCAEGVAI 330
            .:.||:.:::||:.||||: ::.|...|..:.::   .|.|..:||.          |..:|.||
  Rat   224 IMEEIVNWDADIISLQEVETEQYFTLFLPALKDR---GYDGFFSPKSRAKIMSEQERKHVDGCAI 285

  Fly   331 FFRNSRFDLLDSQILHL---------GSNIPALPVFESLWNKI--KVNAQLAERICERSTTLQTC 384
            ||:..:|.|:....:..         ||        |::.|::  |.|..:|..:........|.
  Rat   286 FFKTEKFTLVQKHTVEFNQVAMANSDGS--------EAMLNRVMTKDNIGVAVVLEVHKELFGTG 342

  Fly   385 LLRIKGTDNYVL-VANTHLYFHPDADHIRLLQMGFSMLFVEQSISKAIKDF--NISSH------- 439
            :..|...|..:| |||.|:::.|:...::|:|   :|:||.:     :|:.  ..||.       
  Rat   343 MKPIHAADKQLLIVANAHMHWDPEYSDVKLIQ---TMMFVSE-----VKNILEKASSRPGSPTAD 399

  Fly   440 -KNIGLIFCGDFNSVPECGI------------YKLMTEQLAEKTLEDWQSNAEQAVSNVELAQPF 491
             .:|.|:.|.|.||:|:.|:            :|...|....:.|.::..:.:...|...:...|
  Rat   400 PNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGRITHGF 464

  Fly   492 KMASAY--GAPEYTHYTTLFAGCLDYVFYQNDRFEVLKVV-PLPTEEELKAN-TAIPSAVFPSDH 552
            ::.|||  ....||:||..|.|.:||:||......||.|: ||..:..::.| |..|....||||
  Rat   465 QLKSAYENNLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDH 529

  Fly   553 VALVADLK 560
            .:|:..|:
  Rat   530 FSLLTQLE 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 101/371 (27%)
Cnot6lXP_006250770.1 leucine-rich repeat 38..57 CDD:275378
LRR <57..>183 CDD:227223 17/83 (20%)
leucine-rich repeat 58..80 CDD:275378
leucine-rich repeat 81..103 CDD:275378
leucine-rich repeat 104..126 CDD:275378 5/12 (42%)
leucine-rich repeat 127..138 CDD:275378 5/17 (29%)
Deadenylase_CCR4b 191..538 CDD:197339 101/371 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.