DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and CNOT6L

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001374771.1 Gene:CNOT6L / 246175 HGNCID:18042 Length:616 Species:Homo sapiens


Alignment Length:461 Identity:119/461 - (25%)
Similarity:196/461 - (42%) Gaps:116/461 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VTPEDIG--YHLKFVVTPGNALGMTG-PVVEKITNSAVQESPGRCPFQDRQRHTTN--------- 229
            |.|.::|  :.|:       .||:.| |:.:.|.|  :.:.|      |..|...|         
Human   177 VLPYELGRLFQLQ-------TLGLKGNPLSQDILN--LYQDP------DGTRKLLNFMLDNLAVH 226

  Fly   230 ----------SLSESNEI------RVVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRKPLFI 278
                      :|.|.::|      .|:.||:|.|.||:..     |:.|||:..|..:|||...:
Human   227 PEQLPPRPWITLKERDQILPSASFTVMCYNVLCDKYATRQ-----LYGYCPSWALNWEYRKKGIM 286

  Fly   279 NEIIGYNSDILCLQEVD-QRIFDFDLKEILEQPPYNYHGIMAPKG----------KCAEGVAIFF 332
            .||:..::||:.||||: ::.|...|..:.|:   .|.|..:||.          |..:|.||||
Human   287 EEIVNCDADIISLQEVETEQYFTLFLPALKER---GYDGFFSPKSRAKIMSEQERKHVDGCAIFF 348

  Fly   333 RNSRFDLLDSQILHL---------GSNIPALPVFESLWNKI--KVNAQLAERICERSTTLQTCLL 386
            :..:|.|:....:..         ||        |::.|::  |.|..:|..:..........:.
Human   349 KTEKFTLVQKHTVEFNQVAMANSDGS--------EAMLNRVMTKDNIGVAVVLEVHKELFGAGMK 405

  Fly   387 RIKGTDNYVL-VANTHLYFHPDADHIRLLQMGFSMLFVEQSISKAIKDF--NISSH--------K 440
            .|...|..:| |||.|:::.|:...::|:|   :|:||.:     :|:.  ..||.        .
Human   406 PIHAADKQLLIVANAHMHWDPEYSDVKLIQ---TMMFVSE-----VKNILEKASSRPGSPTADPN 462

  Fly   441 NIGLIFCGDFNSVPECGI------------YKLMTEQLAEKTLEDWQSNAEQAVSNVELAQPFKM 493
            :|.|:.|.|.||:|:.|:            :|...|....:.|.::..|.:...|...:...|::
Human   463 SIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQL 527

  Fly   494 ASAY--GAPEYTHYTTLFAGCLDYVFYQNDRFEVLKVV-PLPTEEELKAN-TAIPSAVFPSDHVA 554
            .|||  ....||:||..|.|.:||:||......||.|: ||..:..::.| |..|....||||.:
Human   528 KSAYENNLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFS 592

  Fly   555 LVADLK 560
            |:..|:
Human   593 LLTQLE 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 102/371 (27%)
CNOT6LNP_001374771.1 leucine-rich repeat 99..118 CDD:275378
LRR <118..>244 CDD:227223 16/81 (20%)
leucine-rich repeat 119..141 CDD:275378
leucine-rich repeat 142..156 CDD:275378
Deadenylase_CCR4b 252..599 CDD:197339 102/371 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.