DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and ANGEL1

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001357675.1 Gene:ANGEL1 / 23357 HGNCID:19961 Length:744 Species:Homo sapiens


Alignment Length:463 Identity:96/463 - (20%)
Similarity:185/463 - (39%) Gaps:78/463 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EPIDAILARIQSNIIGRLAKSCKKSKI--KPPAEINVKLLSDKYGEKFNELTFEDLVVTQDISNV 102
            |..:.:|.:.:...:.::..:..:..:  |..|:.::.||.|..||:  ....||...::.:|::
Human    55 EECEGLLQQWREEGLSQVLSTASEGPLIDKGLAQSSLALLMDNPGEE--NAASEDRWSSRQLSDL 117

  Fly   103 K-LQVLDTVYDLVFNPPWISSLKFLPSCILAGFVIYPTNVQIQFGERQFSKAVWFKAKKPTDTDW 166
            : .:.||..:..:.....:..::.:...:.|.       :.:| .|.|::..............|
Human   118 RAAENLDEPFPEMLGEEPLLEVEGVEGSMWAA-------IPMQ-SEPQYADCAALPVGALATEQW 174

  Fly   167 EVCGEGFQYLVTPEDIGYHLKFVVTPGNALGMTGPVVEKITNSAVQESPGRCPFQD---RQRHTT 228
            |.......:.:.||.:... :..:.|...||...|...:|            |:.:   |:....
Human   175 EEDPAVLAWSIAPEPVPQE-EASIWPFEGLGQLQPPAVEI------------PYHEILWREWEDF 226

  Fly   229 NSLSESNEIR----------VVSYNLLA-DLYASSDYAGSTLFSYCPAKYLQIDYRKPLFINEII 282
            ::..::..::          ::|||:|| ||...|    |.|:.:|....|..:||....:.|..
Human   227 STQPDAQGLKAGDGPQFQFTLMSYNILAQDLMQQS----SELYLHCHPDILNWNYRFVNLMQEFQ 287

  Fly   283 GYNSDILCLQEVDQRIFDFDLKEILEQPPYNYHGIMA----PKGKCAEGVAIFFRNSRFDLLDSQ 343
            .::.||||||||.:   |...:::  :|.....|...    ..|...:|.|:.::.:||.||.:.
Human   288 HWDPDILCLQEVQE---DHYWEQL--EPSLRMMGFTCFYKRRTGCKTDGCAVCYKPTRFRLLCAS 347

  Fly   344 ILHLGSNIPALPVFESLWNKIKVNAQLAERICERSTTLQTCLLRIKGTDNY--VLVANTHLYFHP 406
            .:....  |.|    .|.|:..|...|         .||..:....|..:.  :.|||||:.::|
Human   348 PVEYFR--PGL----ELLNRDNVGLVL---------LLQPLVPEGLGQVSVAPLCVANTHILYNP 397

  Fly   407 DADHIRLLQMGFSMLFVEQSISKAIKDFNISSHKNIGLIFCGDFNSVPECGIYKLMTE-QLAEKT 470
            ....::|.||...:..|:       |...:|...:..:|.|||.||||:..:|..:.: :|....
Human   398 RRGDVKLAQMAILLAEVD-------KVARLSDGSHCPIILCGDLNSVPDSPLYNFIRDGELQYHG 455

  Fly   471 LEDWQSNA 478
            :..|:|.|
Human   456 MPAWKSLA 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 67/248 (27%)
ANGEL1NP_001357675.1 EEP 248..>449 CDD:351117 63/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.