DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and Cnot6l

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_849185.2 Gene:Cnot6l / 231464 MGIID:2443154 Length:555 Species:Mus musculus


Alignment Length:463 Identity:119/463 - (25%)
Similarity:198/463 - (42%) Gaps:115/463 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 YL-VTPEDIG--YHLKFVVTPGNALGMTGPVVEKITNSAVQESPGRCPFQDRQRHTTN------- 229
            || |.|.::|  :.|:       .||:||..:.:...|..|:..|       .|...|       
Mouse   113 YLRVLPYELGRLFQLQ-------TLGLTGNPLSQDIMSLYQDPDG-------TRKLLNFMLDNLA 163

  Fly   230 ------------SLSESNEI------RVVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRKPL 276
                        :|.|.::|      .|:.||:|.|.||:..     |:.|||:..|..:|||..
Mouse   164 VHPEQLPPRPWITLKERDQILPSASFTVMCYNVLCDKYATRQ-----LYGYCPSWALNWEYRKKG 223

  Fly   277 FINEIIGYNSDILCLQEVD-QRIFDFDLKEILEQPPYNYHGIMAPKG----------KCAEGVAI 330
            .:.||:.:::||:.||||: ::.|...|..:.::   .|.|..:||.          |..:|.||
Mouse   224 IMEEIVNWDADIISLQEVETEQYFTLFLPALKDR---GYDGFFSPKSRAKIMSEQERKHVDGCAI 285

  Fly   331 FFRNSRFDLLDSQILHL---------GSNIPALPVFESLWNKI--KVNAQLAERICERSTTLQTC 384
            ||:..:|.|:....:..         ||        |::.|::  |.|..:|..:........|.
Mouse   286 FFKTEKFTLVQKHTVEFNQVAMANSDGS--------EAMLNRVMTKDNIGVAVVLEVHKELFGTG 342

  Fly   385 LLRIKGTDNYVL-VANTHLYFHPDADHIRLLQMGFSMLFVEQSISKAIKDF--NISSH------- 439
            :..|...|..:| |||.|:::.|:...::|:|   :|:||.:     :|:.  ..||.       
Mouse   343 MKPIHAADKQLLIVANAHMHWDPEYSDVKLIQ---TMMFVSE-----VKNILEKASSRPGSPTAD 399

  Fly   440 -KNIGLIFCGDFNSVPECGI------------YKLMTEQLAEKTLEDWQSNAEQAVSNVELAQPF 491
             .:|.|:.|.|.||:|:.|:            :|...|....:.|.::..:.:...|...:...|
Mouse   400 PNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGRITHGF 464

  Fly   492 KMASAY--GAPEYTHYTTLFAGCLDYVFYQNDRFEVLKVV-PLPTEEELKAN-TAIPSAVFPSDH 552
            ::.|||  ....||:||..|.|.:||:||......||.|: ||..:..::.| |..|....||||
Mouse   465 QLKSAYENNLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDH 529

  Fly   553 VALVADLK 560
            .:|:..|:
Mouse   530 FSLLTQLE 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 101/371 (27%)
Cnot6lNP_849185.2 Required for interaction with CNOT1, CNOT3 and CNOT7. /evidence=ECO:0000250 1..152 13/52 (25%)
leucine-rich repeat 38..57 CDD:275378
LRR <57..>183 CDD:227223 17/83 (20%)
leucine-rich repeat 58..80 CDD:275378
leucine-rich repeat 81..103 CDD:275378
leucine-rich repeat 104..126 CDD:275378 5/12 (42%)
leucine-rich repeat 127..138 CDD:275378 5/17 (29%)
Nuclease domain. /evidence=ECO:0000250 158..555 104/404 (26%)
Deadenylase_CCR4b 191..538 CDD:197339 101/371 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.