DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and ccr-4

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001129877.1 Gene:ccr-4 / 178184 WormBaseID:WBGene00000376 Length:677 Species:Caenorhabditis elegans


Alignment Length:371 Identity:93/371 - (25%)
Similarity:174/371 - (46%) Gaps:80/371 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 VVSYNLLADLYASSDYAGSTLFSYCPAKYLQIDYRKPLFINEIIGYNSDILCLQEVD----QRIF 299
            |:.||:|.|.||:.:.     :||||:..|..:|||.|.|.||..|.:|::.||||:    :.:|
 Worm   293 VLCYNVLCDKYATVNQ-----YSYCPSWALNWEYRKGLIIKEIRTYEADVITLQEVETEQFRTLF 352

  Fly   300 DFDLKEILEQPPYNYHGIMAPKG----------KCAEGVAIFFRNSRFDLLDSQILHLGSNIPAL 354
            ..:||::      .|.||...|.          |..:|.|||::..:|| :|.|.|...|::   
 Worm   353 QPELKQL------GYAGIFEAKSRAKTMGEEERKYVDGCAIFWKVDKFD-MDKQYLFEFSSV--- 407

  Fly   355 PVFESLWNKIKVNAQLAERICERSTTLQTCLLRIKGT---------------DNYV----LVANT 400
                 ...|...:..:..|:..|.......:|:||.:               ||.|    :||..
 Worm   408 -----AMKKASTSENMLNRVMPRDNIGLCAVLKIKESVYANKFLGRMQIPMNDNVVGNPLVVATA 467

  Fly   401 HLYFHPDADHIRLLQMGFSMLF---VEQSISKAIKDFNISSHKNIGLIFCGDFNSVPECGIYKLM 462
            |:::.|:...::|:|   ||:.   |.:.:.:..|.:.| :.:.:.::.||||||:|:.|:::.:
 Worm   468 HIHWDPEFCDVKLVQ---SMMLTHEVSRVLEEVSKKYQI-TQQQVPVLICGDFNSLPDSGVFEYL 528

  Fly   463 TE-QLA-----------EKTLEDWQSNAEQAVSNVELAQPFKMASA--YGAPEYTHYTTLFAGCL 513
            :: |:.           :..||.:.::.::.|    ::.|.::.||  ..:..:|:||..|.|.:
 Worm   529 SKGQITRRHMDLKSFRDDSCLEKFTNSTDKNV----ISHPLRLDSACDINSIPFTNYTLDFKGMI 589

  Fly   514 DYVFYQNDRFEVLKVVPLPTEEELKANTAI--PSAVFPSDHVALVA 557
            ||:|........|.::.....:.:::|..:  |.....|||:.::|
 Worm   590 DYIFATPQSLARLGILGPFDPQWVQSNKILGFPHPHVASDHIPIMA 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 93/371 (25%)
ccr-4NP_001129877.1 Deadenylase_CCR4 293..639 CDD:197331 93/371 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.