DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and Cnot6

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001277670.1 Gene:Cnot6 / 104625 MGIID:2144529 Length:557 Species:Mus musculus


Alignment Length:471 Identity:121/471 - (25%)
Similarity:203/471 - (43%) Gaps:123/471 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 QYLVTPEDIG--YHLKFVVTPGNALGMTGPVVEKITNSAVQESPGRCPFQDRQRHTTN------- 229
            |..|.|.::|  :.|:.:...||      |:.:.|.|        .|...|..|...|       
Mouse   108 QLRVLPFELGKLFQLQTLSLKGN------PLTQDILN--------LCLEPDGTRRLLNYLLDNLS 158

  Fly   230 -----------------SLSESNEIR------VVSYNLLADLYASSDYAGSTLFSYCPAKYLQID 271
                             .|.|.:..|      |:.||:|.|.||:..     |:.|||:..|..|
Mouse   159 GTAKRISTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQ-----LYGYCPSWALNWD 218

  Fly   272 YRKPLFINEIIGYNSDILCLQEVD-QRIFDFDLKEILEQPPYNYHGIMAPKG----------KCA 325
            |||...|.||:..|:||:.||||: ::.:.|.|.|:.|:   .|:|..:||.          |..
Mouse   219 YRKKAIIQEILSCNADIISLQEVETEQYYSFFLVELKER---GYNGFFSPKSRARTMSEQERKHV 280

  Fly   326 EGVAIFFRNSRFDLLDSQILHLGSNIPALPVFESLWNKIKV-NAQLAERICERSTTLQ----TCL 385
            :|.||||:..:|.|:....:.              :|::.: |::.:|.:..|..|..    ..|
Mouse   281 DGCAIFFKTEKFTLVQKHTVE--------------FNQLAMANSEGSEAMLNRVMTKDNIGVAVL 331

  Fly   386 LRIK-------------GTD-NYVLVANTHLYFHPDADHIRLLQMGFSMLFVEQ------SISKA 430
            |.::             ||: ..:||||.|:::.|:...::|:|   :|:|:.:      ..|::
Mouse   332 LELRKELIEMSSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQ---TMMFLSEVKNIIDKASRS 393

  Fly   431 IKDFNISSHKNIGLIFCGDFNSVPECGI------------YKLMTEQLAEKTLEDWQSNAEQAVS 483
            :|...:.....|.|:.|.|.||:|:.|:            :|...|....::|.::..|.:..::
Mouse   394 LKSSVLGECGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGMT 458

  Fly   484 NVELAQPFKMASAY--GAPEYTHYTTLFAGCLDYVFYQNDRFEVLKVV-PLPTEEELKAN-TAIP 544
            |..:...||:.|||  |...||:||..|.|.:||:||...:...|.:: ||.....::.| :..|
Mouse   459 NGRITHGFKLKSAYENGLMPYTNYTFDFKGIIDYIFYSKPQLNTLAILGPLDHHWLVENNISGCP 523

  Fly   545 SAVFPSDHVALVADLK 560
            ..:.||||.:|.|.|:
Mouse   524 HPLIPSDHFSLFAQLE 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 104/374 (28%)
Cnot6NP_001277670.1 LRR <52..>159 CDD:227223 14/64 (22%)
LRR 1 52..73
leucine-rich repeat 53..75 CDD:275378
LRR 2 75..96
leucine-rich repeat 76..98 CDD:275378
LRR 3 98..120 4/11 (36%)
leucine-rich repeat 99..121 CDD:275378 4/12 (33%)
LRR 4 121..143 7/35 (20%)
leucine-rich repeat 122..133 CDD:275378 4/16 (25%)
Nuclease domain. /evidence=ECO:0000250 153..557 107/412 (26%)
Deadenylase_CCR4a 191..540 CDD:197340 104/374 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.