DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31759 and angel2

DIOPT Version :9

Sequence 1:NP_723735.2 Gene:CG31759 / 326158 FlyBaseID:FBgn0051759 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_002934749.2 Gene:angel2 / 100379750 XenbaseID:XB-GENE-985562 Length:526 Species:Xenopus tropicalis


Alignment Length:405 Identity:98/405 - (24%)
Similarity:157/405 - (38%) Gaps:114/405 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 EIRVVSYNLLA-DLYASSDYAGSTLFSYCPAKYLQIDYRKPLFINEIIGYNSDILCLQEVDQRIF 299
            :..|:|||:|: ||...:    |.|:.:|....|...||.|..:.|::..|:||||||||.:..:
 Frog   155 DFTVLSYNILSQDLLEDN----SHLYDHCRRPLLFWSYRLPNILKELVDLNADILCLQEVQEDHY 215

  Fly   300 DFDLKEILEQPPYNYH-GIMAPKGKCAEGVAIFFRNSRFDLLD-SQILHLGSNIPALPVFESLWN 362
            ...:|..||.  ..|| ......|...:|.||.|:.::|.|:. :.:.:...||..|        
 Frog   216 TTQIKPSLES--LGYHCEYKTRTGSKPDGCAICFKANKFSLVSVTPVEYYRPNISLL-------- 270

  Fly   363 KIKVNAQLAERICERSTTLQTCLLRIKG--TDNYVLVANTHLYFHPDADHIRLLQMGFSMLFVEQ 425
                         :|.......|||.|.  ....:.||||||.::|....|:|.|:...:..:..
 Frog   271 -------------DRDNIGLVLLLRPKSQRVAPVICVANTHLLYNPRRGDIKLAQLAILLAEITS 322

  Fly   426 SISKAIKDFNISSHKNIGLIFCGDFNSVPECGIYKLMTE-------------------------- 464
            ......|.|       ..::.||||||||...::..:.|                          
 Frog   323 VAFTGEKGF-------CPIVLCGDFNSVPGSPLHSFIREGRLNYEGLSIGKVSGQEQYPRGQKIL 380

  Fly   465 ---------QLAEKTLEDWQSNAEQAVSNVE----------------LAQPFKMASAY------- 497
                     .:::..:.:...||..|...|:                |:..|.::|.|       
 Frog   381 SIPIWPKSLGISQNCVYEPMENAWNAAEMVDKESVGNSARNRQVEPSLSHHFSLSSVYTHFFPGS 445

  Fly   498 GAPEYTHYTTLFAGCLDYVFYQ---NDRF------------EVLKVVPLPTEEELKANTAIPSAV 547
            |.||.|...:..|..:||:||.   ||.|            ::|..:.|.||::|.:...:|:..
 Frog   446 GIPEITTCHSRCALTVDYIFYSAAANDLFAQLGTNSSQNGLQLLGRLSLLTEQDLWSVNGLPNET 510

  Fly   548 FPSDHVALVADLKFK 562
            ..|||::|:|  ||:
 Frog   511 NSSDHLSLLA--KFR 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31759NP_723735.2 EEP 239..561 CDD:294334 96/399 (24%)
angel2XP_002934749.2 PLN03144 <148..523 CDD:178689 97/403 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724242at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.