Sequence 1: | NP_001033884.2 | Gene: | mon2 / 326157 | FlyBaseID: | FBgn0031985 | Length: | 1684 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163691.2 | Gene: | Efa6 / 42665 | FlyBaseID: | FBgn0051158 | Length: | 1601 | Species: | Drosophila melanogaster |
Alignment Length: | 300 | Identity: | 56/300 - (18%) |
---|---|---|---|
Similarity: | 90/300 - (30%) | Gaps: | 123/300 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 490 VIQRTPELHPSHNTAVITEEEHKPLCLQLVNSSWSALLSA------FIPLVETSIDEATTENILK 548
Fly 549 AMQNYAALCGMLEQL----QPRDAFIMAMCRASF----PPHY----AMSIF-------------- 587
Fly 588 -------ANTTQSDGDLR-----------------------------CHTRSGSQDLSSQF---- 612
Fly 613 ---------------INSCSGDAG----------DFRPQIV-------AVGTPLPSASLPHSVMQ 645
Fly 646 APVMLTNKNLQCMRAILFLAHNNGGILGTSWHIVLQTLQH 685 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mon2 | NP_001033884.2 | DCB | 13..184 | CDD:292830 | |
Sec7_N | 213..380 | CDD:289549 | |||
DUF1981 | 827..909 | CDD:286414 | |||
Mon2_C | 912..1665 | CDD:292823 | |||
Efa6 | NP_001163691.2 | PDZ_signaling | 7..85 | CDD:238492 | 16/84 (19%) |
PHA03269 | 225..>344 | CDD:165527 | 18/74 (24%) | ||
Sec7 | 1124..1293 | CDD:238100 | |||
PH_EFA6 | 1330..1452 | CDD:270107 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45452086 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10663 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |