DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mon2 and Efa6

DIOPT Version :9

Sequence 1:NP_001033884.2 Gene:mon2 / 326157 FlyBaseID:FBgn0031985 Length:1684 Species:Drosophila melanogaster
Sequence 2:NP_001163691.2 Gene:Efa6 / 42665 FlyBaseID:FBgn0051158 Length:1601 Species:Drosophila melanogaster


Alignment Length:300 Identity:56/300 - (18%)
Similarity:90/300 - (30%) Gaps:123/300 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 VIQRTPELHPSHNTAVITEEEHKPLCLQLVNSSWSALLSA------FIPLVETSIDEATTENILK 548
            |:.|..|.|.....:::.......:...:|.:|.:|...|      .:.:..|.:...||:.:||
  Fly     7 VVLRRSEQHSGFGFSLLGTTGPPHVIYDIVENSPAADCGAVEAGDVILKVNGTDVHRYTTKEVLK 71

  Fly   549 AMQNYAALCGMLEQL----QPRDAFIMAMCRASF----PPHY----AMSIF-------------- 587
            .::       :.|||    ..||..:.|..:...    .|||    :.:|:              
  Fly    72 CLR-------LSEQLVTLELKRDPKLKARIKEQLANTQSPHYVDIESPNIYDYHSSSTNSSPNHR 129

  Fly   588 -------ANTTQSDGDLR-----------------------------CHTRSGSQDLSSQF---- 612
                   |.||.|...||                             .||.|.|::.|:..    
  Fly   130 PNAGGKGAATTPSQTGLRYKSPTHLPSLRQNSSPLLASGSTTTTTTATHTHSHSRNSSASSTKIK 194

  Fly   613 ---------------INSCSGDAG----------DFRPQIV-------AVGTPLPSASLPHSVMQ 645
                           :.|.:|..|          .|||..:       ||..|:|....|.:...
  Fly   195 VVETSITTSTTNVVGLTSPTGSVGGGVGGEATSPTFRPSRIPQALTKCAVPKPVPVLHSPQNKRP 259

  Fly   646 APVMLTNKNLQCMRAILFLAHNNGGILGTSWHIVLQTLQH 685
            .|..:..|          .|:.||.  |.:.|:..|:|||
  Fly   260 RPSQIPTK----------AANGNGN--GHTAHLPPQSLQH 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mon2NP_001033884.2 DCB 13..184 CDD:292830
Sec7_N 213..380 CDD:289549
DUF1981 827..909 CDD:286414
Mon2_C 912..1665 CDD:292823
Efa6NP_001163691.2 PDZ_signaling 7..85 CDD:238492 16/84 (19%)
PHA03269 225..>344 CDD:165527 18/74 (24%)
Sec7 1124..1293 CDD:238100
PH_EFA6 1330..1452 CDD:270107
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10663
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.