DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31743 and Chst10

DIOPT Version :10

Sequence 1:NP_609820.1 Gene:CG31743 / 326156 FlyBaseID:FBgn0032618 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_006496427.1 Gene:Chst10 / 98388 MGIID:2138283 Length:374 Species:Mus musculus


Alignment Length:49 Identity:13/49 - (26%)
Similarity:19/49 - (38%) Gaps:7/49 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GAIEEGFKAIVRCVRSKVQYFAKRLHNSMAGLGTN-------DKTLIRI 78
            ||:.......||...:||.:.|.|..|......:|       |:.|:.|
Mouse    76 GAVTSSLGISVRSGSAKVAFSATRSTNHEPSEMSNRTMTIYFDQVLVNI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31743NP_609820.1 Sulfotransfer_2 84..319 CDD:427369
Chst10XP_006496427.1 Sulfotransfer_2 134..367 CDD:427369
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.