DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31743 and T27C5.12

DIOPT Version :10

Sequence 1:NP_609820.1 Gene:CG31743 / 326156 FlyBaseID:FBgn0032618 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001024165.1 Gene:T27C5.12 / 3564801 WormBaseID:WBGene00044059 Length:309 Species:Caenorhabditis elegans


Alignment Length:96 Identity:20/96 - (20%)
Similarity:37/96 - (38%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 HMIVDKEHKLLYCYVPKVACTNWKRVLMMLTN--KWHNGTDPLQIPGSLAHSVGMFTKLYDLSEA 142
            :.|....:|::.|.:.|........::.:|.|  .:....|.|.....:..|.......|    .
 Worm    58 YFITAPRNKIIMCGIRKSMSLLSTNIMCLLNNVDPFFANNDALNEDWKVERSCQRNHSFY----F 118

  Fly   143 EQQQVLSDEYT-RFILVRHPLERLLSAYRNK 172
            ...::|:|..| |...:|.|.:|.:|.|.:|
 Worm   119 PPSELLNDSNTVRLAFIRDPFQRFVSFYLDK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31743NP_609820.1 Sulfotransfer_2 84..319 CDD:427369 19/92 (21%)
T27C5.12NP_001024165.1 Sulfotransfer_2 62..294 CDD:427369 19/92 (21%)

Return to query results.
Submit another query.