DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AspRS-m and fam3a

DIOPT Version :9

Sequence 1:NP_001260520.2 Gene:AspRS-m / 326155 FlyBaseID:FBgn0051739 Length:1139 Species:Drosophila melanogaster
Sequence 2:NP_001007862.1 Gene:fam3a / 493248 XenbaseID:XB-GENE-968990 Length:230 Species:Xenopus tropicalis


Alignment Length:209 Identity:42/209 - (20%)
Similarity:67/209 - (32%) Gaps:61/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 MNSQPPQPMRQSCGELR----NHHCGLFVELSGRLIKKRVNRFAELRDRNGGACQLVVLEDKHPR 196
            |::..|:|.|..||..|    .|.....|..:..:|..::             |    |||| ..
 Frog    46 MSTADPRPRRYKCGLPRPCPEKHFAFRVVSGAANVIGPKI-------------C----LEDK-ML 92

  Fly   197 VARRMNNMPENTTLTIVGLVMRRPHNSCNQTMPTGEIEVEVQDILNIH---------FPAGGTKR 252
            ::...||:.....:.:|..|.....|:....|.:|::...:..:..||         |....||.
 Frog    93 LSSIQNNVGRGLNVALVNGVNGELINAKTFDMWSGDVTELLSFLRPIHEGTVVMIASFDDPATKM 157

  Fly   253 AGDKRTYSTMVQQQS--NLGITST---------------EYKIAKNENILKYFENRDLTCNDLRR 300
            ..|.|.....:...|  ::|...:               |..|..|:|..||             
 Frog   158 TEDIRKLFAELGSASIKDVGFRDSWAFVGAKGVQDKSPFEQLIKNNKNTNKY------------- 209

  Fly   301 DDVGKTVTLVGWIP 314
            :...:.|.|.|.||
 Frog   210 EGWPEAVELEGCIP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AspRS-mNP_001260520.2 RPA_2b-aaRSs_OBF_like 148..303 CDD:415809 33/184 (18%)
EcAspRS_like_N 291..410 CDD:239812 5/24 (21%)
aspS 462..1045 CDD:234775
fam3aNP_001007862.1 ILEI_FAM3C 53..223 CDD:260114 38/200 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165178355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.