DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AspRS-m and slm5

DIOPT Version :9

Sequence 1:NP_001260520.2 Gene:AspRS-m / 326155 FlyBaseID:FBgn0051739 Length:1139 Species:Drosophila melanogaster
Sequence 2:NP_595079.1 Gene:slm5 / 2539632 PomBaseID:SPBC1198.10c Length:441 Species:Schizosaccharomyces pombe


Alignment Length:606 Identity:126/606 - (20%)
Similarity:199/606 - (32%) Gaps:240/606 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 HNCGELTSNDINEKVVICGWLEFQRMNK---FFILRDAYGQ--TQVLLSPK-----TYGLEEYAE 518
            || |||.|        |.||:...|..|   |.::.|...|  .||:.||:     :||      
pombe    18 HN-GELIS--------INGWVRSIRKLKNVCFAMVSDGTCQQALQVVTSPEQSKKLSYG------ 67

  Fly   519 TGVPIESIVRVEGTVIPRPAATINPKMQTGHVEVEADKVVVLNPAK-KNLPFEIRKFNRAGERLR 582
                  :.|.:||.:    |.:.|.|:.....|:.|:|:.:..... .|.|  |:|.:...|.||
pombe    68 ------ASVNIEGQL----AVSKNAKLGLQQYELLAEKIKIYGQINDDNYP--IQKKHLTTEMLR 120

  Fly   583 -LTHRYLDLRFNDMQHNLRLRSAVIMKMREYLINYLGFVEVETPTLFRRTPGGAQEFVVPTRK-- 644
             :.|  |.||........||||..:..:|:: .:...|.|...|.:......||.|....|.:  
pombe   121 QIPH--LRLRTAKQGEIFRLRSDSLKALRQF-FSSKDFTETNPPIITSSDCEGAGEVFTLTPQET 182

  Fly   645 ----------AGHFYS----LVQSPQQFKQMLMSGGIDRYFQVARCYRDEATRPDRQ-PEFTQLD 694
                      ..||:.    |..|.|...:.| :.|:.|.:.::..:|.|.:...|. .||..|:
pombe   183 HKNKSFERDDQKHFFDRPAFLTVSTQLHLEAL-ALGLSRVYTISPAFRAEQSHTSRHLAEFWMLE 246

  Fly   695 IELSF-TSRDDIMQLIEETLRY--------SWPKD-FPRLQTPFRRITYEEAME----------- 738
            .|::| ||...:..|:|:.::|        ::.:| :.:|..|::.:||.||:|           
pombe   247 AEVAFMTSLSQLTSLMEDMIKYTLNSLMEQNYHRDHWDQLLKPWKCMTYSEAIEELSAVKKTWKY 311

  Fly   739 --KYGNDKPDTRFGFLLNNVSEIIEKSDEFKEKYDDLGAYAIVVRASEAFWNGAARKHYESLGKE 801
              |:|||.......:|    .||:.|:..|...|                               
pombe   312 PPKWGNDLSSEHEKYL----CEILHKTPVFVTDY------------------------------- 341

  Fly   802 FKGTLFVRKFGPTKDVQEKLGKLLGEDVATEVADKFDLEENDLLFLGIGSKVETRELLGRIRLDY 866
                       |.| ::....|..|.|....|         |||...:|                
pombe   342 -----------PQK-IKPFYMKSSGPDTVAAV---------DLLVPQVG---------------- 369

  Fly   867 QDFLVENAKIKKPNDFRFLWVIDFPLFERNRETNQLESVHHPFTLPHSDDLENFATSCENLESIR 931
                                                                             
pombe   370 ----------------------------------------------------------------- 369

  Fly   932 SQAYDLVLNGQEVGGGSIRIHDRDMQHFILEQILKIPHDHLSHLLSALESGCPPHGGIALGLDRL 996
                       |:.|||:|     ..|  |::....|.: |...|..::....||||..||::||
pombe   370 -----------ELAGGSLR-----KDH--LDEYKTYPPE-LQWYLDLMKYSNAPHGGFGLGIERL 415

  Fly   997 IAIL-CRARSIRDVIAFPKSL 1016
            ||.| ....::::.|.||:|:
pombe   416 IAFLEGENTNVKETIPFPRSV 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AspRS-mNP_001260520.2 RPA_2b-aaRSs_OBF_like 148..303 CDD:415809
EcAspRS_like_N 291..410 CDD:239812
aspS 462..1045 CDD:234775 126/606 (21%)
slm5NP_595079.1 asnC 9..439 CDD:235176 126/606 (21%)
EcAsnRS_like_N 23..101 CDD:239813 24/101 (24%)
AsxRS_core 113..434 CDD:238399 91/480 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.