DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AspRS-m and smn1

DIOPT Version :9

Sequence 1:NP_001260520.2 Gene:AspRS-m / 326155 FlyBaseID:FBgn0051739 Length:1139 Species:Drosophila melanogaster
Sequence 2:NP_001093710.1 Gene:smn1 / 100101724 XenbaseID:XB-GENE-489160 Length:282 Species:Xenopus tropicalis


Alignment Length:193 Identity:39/193 - (20%)
Similarity:54/193 - (27%) Gaps:90/193 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 LIK---KRVNRFAELRDRNGGACQLVVLEDKHPRVARRMNNMPENTTLTIVGLVMRRPHNSCNQT 227
            |||   |.|:.|.:.. :||........|:|.||..|:.|.             ..|....||  
 Frog    30 LIKAYDKAVSSFKKAL-KNGDCTVSAEAEEKIPRTKRKNNK-------------KNRSRKKCN-- 78

  Fly   228 MPTGEIEVEVQDILNIHFPAGGTK--RAGDKRTYSTMVQQQSNLGITSTEYKIAKNENILKYFEN 290
                               |...|  |.||                                   
 Frog    79 -------------------AAPLKKWRVGD----------------------------------- 89

  Fly   291 RDLTCNDLRRDD---VGKTVTLVGWIPSTKNNKFLQLKDGYGQTQLMIEDQSLSD-TFLSTPE 349
               |||.:..:|   ...|::.:    ..|....:.:..|||.:    |:|||:| .|..|.|
 Frog    90 ---TCNAIWSEDGNIYPATISSI----DAKKGTCIVVYSGYGNS----EEQSLADLRFPDTSE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AspRS-mNP_001260520.2 RPA_2b-aaRSs_OBF_like 148..303 CDD:415809 26/144 (18%)
EcAspRS_like_N 291..410 CDD:239812 17/63 (27%)
aspS 462..1045 CDD:234775
smn1NP_001093710.1 SMN 18..282 CDD:310529 39/193 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0173
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.