DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31689 and Abca15

DIOPT Version :9

Sequence 1:NP_001259954.1 Gene:CG31689 / 326154 FlyBaseID:FBgn0031449 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_796187.2 Gene:Abca15 / 320631 MGIID:2388709 Length:1668 Species:Mus musculus


Alignment Length:209 Identity:64/209 - (30%)
Similarity:97/209 - (46%) Gaps:19/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LKGIKGTFKSGELTAIMGPSGAGKSSLMNILTG--------LTKSGVSGKIEIGKARKLCGYIMQ 101
            :|.|....:......::|.:||||::...||||        :...|:|....|.|.|...||..|
Mouse  1372 VKNISLAIQERACFGLLGFNGAGKTTTFQILTGENIPTAGDVFIDGISLTKNIVKVRSKIGYCPQ 1436

  Fly   102 DDHFFPYFTVEETMLMAATLKISNQCVSLKEKRTLIDYLLNSLKLTKTRQTKCSNLSGGQKKRLS 166
            .|....|.|..|.|:|.|.:    ..:|..:.:..:...||||.|.....:..|..|.|.|:|||
Mouse  1437 FDALLEYMTGWEIMIMYARI----WGISEHQIQPYVKKYLNSLDLESHANSLISTYSEGNKRRLS 1497

  Fly   167 IALELIDNPAVLFLDEPTTGLDSSSS---FDTIQLLRGLANEGRTIVCTIHQPSTNIYNLFNLVY 228
            .|:..:..|:|:|||||:||:|..:.   :||:..:|   ..|:.|:.|.|. ......|...:.
Mouse  1498 TAIATMGKPSVIFLDEPSTGMDPRARRLLWDTVIKIR---ESGKAIIITSHS-MEECEALCTRLS 1558

  Fly   229 VLSAGRCTYQGTPQ 242
            ::..||.|..|:||
Mouse  1559 IMVRGRLTCLGSPQ 1572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31689NP_001259954.1 3a01204 15..622 CDD:273361 64/209 (31%)
ABCG_EPDR 26..239 CDD:213180 61/204 (30%)
ABC2_membrane 355..558 CDD:279410
Abca15NP_796187.2 ABC2_membrane_3 144..464 CDD:289468
ABC2_membrane <267..383 CDD:304374
CcmA 522..831 CDD:224054
ABC_subfamily_A 522..743 CDD:213230
ABC2_membrane_3 <1009..1231 CDD:289468
CcmA 1354..1648 CDD:224054 64/209 (31%)
ABC_subfamily_A 1354..1575 CDD:213230 64/209 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.