DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31689 and Abca5

DIOPT Version :9

Sequence 1:NP_001259954.1 Gene:CG31689 / 326154 FlyBaseID:FBgn0031449 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_775429.1 Gene:Abca5 / 286970 RGDID:628661 Length:1642 Species:Rattus norvegicus


Alignment Length:348 Identity:95/348 - (27%)
Similarity:146/348 - (41%) Gaps:56/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YRVEVGKDREKKSVLKGIKGTFKSGELTAIMGPSGAGKSSLMNILTGLTKSG----------VSG 85
            ||    |..|....|:.:......|::||::|.||.|||:|||||.||....          ||.
  Rat   487 YR----KKNETVEALRNLSFDIYEGQITALLGHSGTGKSTLMNILCGLCPPSDGFASIYGHRVSE 547

  Fly    86 KIEIGKARKLCGYIMQDDHFFPYFTVEETMLMAATLK-ISNQCVSLKEKRTLIDYLLNSLKLTKT 149
            ..|:.:|||:.|...|.|..|...||||.:.:.|::| |....:..:.::.|:|..:.::|    
  Rat   548 IDEMFEARKMIGICPQSDMNFDVLTVEENLSILASVKGIPANNIIQEVQKVLLDLDMQAIK---- 608

  Fly   150 RQTKCSNLSGGQKKRLSIALELIDNPAVLFLDEPTTGLDSSSSFDTIQLLRGLANEGRTIVCTIH 214
             ..:...||||||::||:.:.::.||.:|.|||||.|:|..|......||:.......|:..|..
  Rat   609 -DNQAKKLSGGQKRKLSLGIAVLGNPKILLLDEPTAGMDPCSRHIVWNLLKYRKANRVTVFSTHF 672

  Fly   215 QPSTNIYNLFNLVYVLSAGRCTYQGTPQNTVMFLSS---VGLECPPY----------------HN 260
            ....:|  |.:...|:|.|.....|:.    :||.|   :|.....|                |.
  Rat   673 MDEADI--LADRKAVISQGMLKCVGSS----IFLKSKWGIGYRLSMYIDRYCATESLSSLVRQHI 731

  Fly   261 PADFLLECANGDYGDQTEALAEAAKDIRWRYDQQLMQGEDADAPSETQVAKFNESQSPGQVQVQV 325
            ||..||:     ..||....:...||:    |:........|..|...|..:..|.:  .::...
  Rat   732 PAAALLQ-----QNDQQIVYSLPFKDM----DKFSGLFSALDIHSNLGVISYGVSMT--TLEDVF 785

  Fly   326 QKIEIQNMESSKDLTKHTYPPTE 348
            .|:|::......|.:..|..|.|
  Rat   786 LKLEVEAEIDQADYSVFTQQPRE 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31689NP_001259954.1 3a01204 15..622 CDD:273361 95/348 (27%)
ABCG_EPDR 26..239 CDD:213180 69/218 (32%)
ABC2_membrane 355..558 CDD:279410
Abca5NP_775429.1 ABC2_membrane_3 <214..416 CDD:289468
CcmA 476..788 CDD:224054 89/326 (27%)
ABC_subfamily_A 478..701 CDD:213230 71/228 (31%)
ABC2_membrane_3 <957..1224 CDD:289468
CcmA 1288..1615 CDD:224054
ABC_subfamily_A 1290..1521 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.