DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and STOP1

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_174697.1 Gene:STOP1 / 840339 AraportID:AT1G34370 Length:499 Species:Arabidopsis thaliana


Alignment Length:490 Identity:106/490 - (21%)
Similarity:162/490 - (33%) Gaps:122/490 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 GATSSVASPPSTAAVQQFVSSRHQELLSQYPLLYYAPNQLMCAAAAAQYAALTAQQQSLASA--- 196
            |..:....|.:..:...|:..:..:|.....||.....||.     .:...|.||||.|.:.   
plant    70 GVRAQAWDPRTMLSNLSFMEQKIHQLQDLVHLLVGRGGQLQ-----GRQDELAAQQQQLITTDLT 129

  Fly   197 ---AHLSSFTASLNASLHHSQSLRRN--LGHPLAAA-----AAVAAVAQSQAVPNL---QHTLEK 248
               ..|.|...||..|:.|:.|....  .|.|.:|.     .|....:|||...|.   :..|.|
plant   130 SIIIQLISTAGSLLPSVKHNMSTAPGPFTGQPGSAVFPYVREANNVASQSQNNNNCGAREFDLPK 194

  Fly   249 SPVAQRTAQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGG 313
             ||.....:...::.:..:.....::||..||                   ||.|..........
plant   195 -PVLVDEREGHVVEEHEMKDEDDVEEGENLPP-------------------GSYEILQLEKEEIL 239

  Fly   314 KPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCR--HKIIHTSE----K 372
            .|.|..|..|||.|....||..||..|           |..::.|:.|.:  .:.:..||    |
plant   240 APHTHFCTICGKGFKRDANLRMHMRGH-----------GDEYKTAAALAKPNKESVPGSEPMLIK 293

  Fly   373 PHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNH-KLTHSGEKAYKCNICN 436
            .:.|...|...|:.         |..::|.....|         .||| |.||. :|::.|:.|:
plant   294 RYSCPFLGCKRNKE---------HKKFQPLKTILC---------VKNHYKRTHC-DKSFTCSRCH 339

  Fly   437 -KAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHEIGGDLDDLDMPPTYDRRR 500
             |.|..:.:|..| ..|..|..:.|. |...|.|...|..|:....   |....:.:..|     
plant   340 TKKFSVIADLKTH-EKHCGKNKWLCS-CGTTFSRKDKLFGHIALFQ---GHTPAIPLEET----- 394

  Fly   501 EYTRREPLASGYGQASGQLTPDSSSGSMSPPINVTTPPLSSGETSNPAWPRSAV---SQYPP--- 559
                 :|.||...|.......:::.|.:.  .|:.:...::.||:.|......:   ..:.|   
plant   395 -----KPSASTSTQRGSSEGGNNNQGMVG--FNLGSASNANQETTQPGMTDGRICFEESFSPMNF 452

  Fly   560 -----GGFHHQLGVAPPHDYP------SGSAFLQL 583
                 |||         |::|      |.|:|..|
plant   453 DTCNFGGF---------HEFPRLMFDDSESSFQML 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 42/173 (24%)
C2H2 Zn finger 320..340 CDD:275368 9/19 (47%)
zf-H2C2_2 332..357 CDD:290200 6/24 (25%)
zf-C2H2 346..368 CDD:278523 3/23 (13%)
C2H2 Zn finger 348..368 CDD:275368 3/21 (14%)
zf-H2C2_2 363..385 CDD:290200 5/27 (19%)
C2H2 Zn finger 376..396 CDD:275368 3/19 (16%)
zf-H2C2_2 389..413 CDD:290200 3/23 (13%)
C2H2 Zn finger 404..424 CDD:275368 5/20 (25%)
zf-H2C2_2 416..441 CDD:290200 11/26 (42%)
C2H2 Zn finger 432..452 CDD:275368 6/20 (30%)
C2H2 Zn finger 460..478 CDD:275368 6/17 (35%)
STOP1NP_174697.1 zf-C2H2 244..266 CDD:333835 9/21 (43%)
C2H2 Zn finger 246..266 CDD:275368 9/19 (47%)
C2H2 Zn finger 297..328 CDD:275368 10/48 (21%)
C2H2 Zn finger 335..354 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..379 CDD:275370 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.