DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and IDD11

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001189882.1 Gene:IDD11 / 820593 AraportID:AT3G13810 Length:514 Species:Arabidopsis thaliana


Alignment Length:559 Identity:109/559 - (19%)
Similarity:160/559 - (28%) Gaps:190/559 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 LKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGG---------------K 314
            |.:.:.||....:     |..|||:|       .|.|:...:...|||.               :
plant     3 LHQHQQPQQDENM-----SNLTSASG-------DQASVSSGNITEASGSNYFPHHQQQQEQQQQQ 55

  Fly   315 PKTFSCLECGKVFNAHYNLTRHMPVH-------------TGARPFVCKVCGKGFRQASTLCRHKI 366
            .:..||.....:|.....:|....::             .....|||::|.|||::...|..|:.
plant    56 IQKLSCSWTDSLFQLFDTVTFLEILYPESEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRR 120

  Fly   367 IHTSEKPHKC-QTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKG-------NYKNHKLT 423
            .|  ..|.|. |...|...|.             |.:||.......|...       ..|.|...
plant   121 GH--NLPWKLKQRSNKEVIRK-------------KVYVCPEASCVHHDPSRALGDLTGIKKHFCR 170

  Fly   424 HSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHEIGGDLD 488
            ..|||.:||:.|:|.:....:...|..|...|: |.|. |...|.|......|......:.    
plant   171 KHGEKKWKCDKCSKKYAVQSDCKAHSKTCGTKE-YRCD-CGTLFSRRDSFITHRAFCEALA---- 229

  Fly   489 DLDMPPTYDRRREYTRRE---PLASGYGQASGQLTPDSSS-----GSMSPPINVTTPPLSS---- 541
                        |.|.||   |......|.:..|...|:|     ....|.|||::...||    
plant   230 ------------EETAREVVIPQNQNNNQPNPLLIHQSASHPHHHHQTQPTINVSSSSSSSHNHN 282

  Fly   542 -----------GETSNPAWPRSAVSQYPPG----------GFHHQLGVAPPHDYPSGSAFLQLQP 585
                       |.|:|.....:.:..:|..          .:||  .:.||...|...|   |..
plant   283 IINSLHFDTNNGNTNNSNNSNNHLHTFPMKKEQQSNDHIMNYHH--SIIPPWLAPQPHA---LTS 342

  Fly   586 QQPHPQS------QQHHQQQQRLSETFIAKVFXQRYYAESLNSSTGSTSTTSSTVTTT------- 637
            ..|:|.:      .........:|.|.:.:.. |          .|||.|.....||.       
plant   343 SNPNPSNGGGGGGSLFSLASPAMSATALLQKAAQ----------MGSTKTPPLPPTTAYERSTHN 397

  Fly   638 ---TTAISSMATSRSDLL----------------------------------IDXLQFVAAAAAA 665
               ||.:::|.||.|..:                                  :. .:..|||.:.
plant   398 NNLTTTMAAMMTSPSGFISSNNNNHVLFQDYNASGFDNHGREEAFDDTFGGFLRTNEVTAAAGSE 462

  Fly   666 SSSNSGQDTG-----------ESPSPELGCTALGSAVRA 693
            .|:.||...|           .|.:..|....|||.:.:
plant   463 KSTKSGGGEGLTRDFLGLRPLMSHNEILSFAGLGSCINS 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 41/201 (20%)
C2H2 Zn finger 320..340 CDD:275368 3/19 (16%)
zf-H2C2_2 332..357 CDD:290200 8/37 (22%)
zf-C2H2 346..368 CDD:278523 9/21 (43%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
zf-H2C2_2 363..385 CDD:290200 6/22 (27%)
C2H2 Zn finger 376..396 CDD:275368 3/20 (15%)
zf-H2C2_2 389..413 CDD:290200 3/23 (13%)
C2H2 Zn finger 404..424 CDD:275368 4/26 (15%)
zf-H2C2_2 416..441 CDD:290200 9/24 (38%)
C2H2 Zn finger 432..452 CDD:275368 4/19 (21%)
C2H2 Zn finger 460..478 CDD:275368 5/17 (29%)
IDD11NP_001189882.1 C2H2 Zn finger 102..122 CDD:275368 7/19 (37%)
C2H2 Zn finger 144..172 CDD:275368 4/27 (15%)
C2H2 Zn finger 179..198 CDD:275368 4/18 (22%)
C2H2 Zn finger 206..222 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.