DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and 2810021J22Rik

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_765991.1 Gene:2810021J22Rik / 69944 MGIID:1917194 Length:539 Species:Mus musculus


Alignment Length:466 Identity:130/466 - (27%)
Similarity:178/466 - (38%) Gaps:146/466 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EPDH-RPSQVPPPQPAPVSFATNDDDEDEDPEIDADSERSCSPIEVISLDQSPSTVNYDSAFKKY 128
            |.|| .||::.|..|||:|             :|..:||                          
Mouse   164 ELDHLNPSKMLPRPPAPLS-------------LDFSAER-------------------------- 189

  Fly   129 VPGPCSGATSSVASPPSTAAVQQFVSSRHQELL--------SQYPLLYYAPNQLMCAAAAAQYAA 185
              ||..|.                 .::|.|..        :.:||...:.|       |....|
Mouse   190 --GPQHGQ-----------------CAQHGEAFDVRTVWTRTVFPLGDSSTN-------AFDKLA 228

  Fly   186 LTAQQQSLASAAHLSSFTASLNA-------SLHHSQSLRRNL---------GHPLAAAAAVAAVA 234
            ||||:     ..|:...|...|.       :.:|::.|:.:|         |.|...|.|     
Mouse   229 LTAQE-----GTHIREETFDCNMCKKPFSDTCNHTRHLKPHLKKQCGKCPDGEPAFRAKA----- 283

  Fly   235 QSQAVPNLQHTL-----------EKSPVAQ----RTAQS--SGLQANLKRKRSPQDQGEVTPPPA 282
                  .|||||           .|..|.|    |:.||  |..::|..:...|.....|...| 
Mouse   284 ------GLQHTLHSWGKPRGCNDNKKCVHQMPKPRSNQSVFSSKESNCVKTFCPDSTLSVQQRP- 341

  Fly   283 STATSATGARSRSPSPQGSIEDSSPGSASGGKP-------KTFSCLECGKVFNAHYNLTRHMPVH 340
                 .||.:     ||   |.|:|...: .:|       :|:.|..|||.|....||..|...|
Mouse   342 -----HTGKK-----PQ---ESSTPVKIN-SQPRRRHRCGRTYQCKVCGKAFKHTQNLYLHHRTH 392

  Fly   341 TGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCE 405
            ||.:|:.||.|.|.|...|.|..|:..||.|||::|..||.||.|...|..|.|:|.|.||:.|:
Mouse   393 TGEKPYECKECKKLFSVKSNLSVHQKTHTGEKPYECNICGNAFKRRCDLTIHQRVHTGEKPYECK 457

  Fly   406 YCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRN 470
            .|.|.|..|.....|:..|:|||.|:|::|.|.|:|..||:.|...|..:||:.|:.|:|.|...
Mouse   458 ECRKTFSIKSGLIVHQRIHTGEKPYECSVCGKRFNQKSNLSTHEKIHTGEKPFECKECSKAFSVK 522

  Fly   471 FDLKKHMRKLH 481
            ..|..| :|.|
Mouse   523 SYLTIH-QKTH 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 67/172 (39%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 332..357 CDD:290200 12/24 (50%)
zf-C2H2 346..368 CDD:278523 8/21 (38%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
zf-H2C2_2 363..385 CDD:290200 11/21 (52%)
C2H2 Zn finger 376..396 CDD:275368 9/19 (47%)
zf-H2C2_2 389..413 CDD:290200 11/23 (48%)
C2H2 Zn finger 404..424 CDD:275368 6/19 (32%)
zf-H2C2_2 416..441 CDD:290200 10/24 (42%)
C2H2 Zn finger 432..452 CDD:275368 8/19 (42%)
C2H2 Zn finger 460..478 CDD:275368 6/17 (35%)
2810021J22RikNP_765991.1 KRAB 8..67 CDD:214630
C2H2 Zn finger 323..342 CDD:275368 4/24 (17%)
zf-C2H2 370..392 CDD:333835 8/21 (38%)
C2H2 Zn finger 372..392 CDD:275368 8/19 (42%)
COG5048 <396..539 CDD:227381 57/138 (41%)
C2H2 Zn finger 400..420 CDD:275368 8/19 (42%)
C2H2 Zn finger 428..448 CDD:275368 9/19 (47%)
C2H2 Zn finger 456..476 CDD:275368 6/19 (32%)
C2H2 Zn finger 484..504 CDD:275368 8/19 (42%)
C2H2 Zn finger 512..532 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.