Sequence 1: | NP_001259891.2 | Gene: | erm / 326152 | FlyBaseID: | FBgn0031375 | Length: | 698 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018612.1 | Gene: | gfi1aa / 553814 | ZFINID: | ZDB-GENE-050522-534 | Length: | 385 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 93/272 - (34%) |
---|---|---|---|
Similarity: | 137/272 - (50%) | Gaps: | 38/272 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 SQAVPNLQHTLEK-SPVAQRTAQSSGLQANLKRKRSP-------------QDQGEVTPP------ 280
Fly 281 -----PASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLECGKVFNAHYNLTRHM-PV 339
Fly 340 HTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVC 404
Fly 405 EYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCR 469
Fly 470 NFDLKKHMRKLH 481 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
erm | NP_001259891.2 | COG5048 | <295..461 | CDD:227381 | 66/166 (40%) |
C2H2 Zn finger | 320..340 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 332..357 | CDD:290200 | 12/25 (48%) | ||
zf-C2H2 | 346..368 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 348..368 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 363..385 | CDD:290200 | 8/21 (38%) | ||
C2H2 Zn finger | 376..396 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 389..413 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 404..424 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 416..441 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 432..452 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 460..478 | CDD:275368 | 9/17 (53%) | ||
gfi1aa | NP_001018612.1 | C2H2 Zn finger | 220..241 | CDD:275368 | 7/20 (35%) |
C2H2 Zn finger | 249..269 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 261..286 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 277..297 | CDD:275368 | 11/19 (58%) | ||
C2H2 Zn finger | 305..325 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 317..342 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 333..353 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 361..380 | CDD:275368 | 9/18 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |