DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and FEZF2

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_060478.3 Gene:FEZF2 / 55079 HGNCID:13506 Length:459 Species:Homo sapiens


Alignment Length:511 Identity:215/511 - (42%)
Similarity:261/511 - (51%) Gaps:128/511 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ACP-----------LKFSIAKIMEPDHRPSQVPPPQPAPVSFATNDDDEDEDPEIDADSERS--- 103
            |||           |.|||.:||.....|.....|:|.               .::||..:.   
Human    14 ACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRPG---------------ALEADGSQGKKL 63

  Fly   104 ---CSPIE-VISLD------QSPSTVNYDSAFKKYV-----------------PGPCSGATS--- 138
               |||:. :|.|.      .|.:.::|...:|..:                 ..|..||:.   
Human    64 LNLCSPLPCMIPLQPLGYEVPSKTLLSYSELWKSSLRAGGGGGGGGGGGGGGGGAPVCGASGLCK 128

  Fly   139 -------------SVASPPSTAAVQQFVSSRHQELLSQYPLLYYAPNQLMCAAAAAQYAALTAQQ 190
                         :.::.|:...::..|.::...|.:...|.|:            .|...||..
Human   129 TNCGVCCKAELGLAPSALPAGRVIKPQVINQAVGLPASGSLYYF------------NYLDSTAYP 181

  Fly   191 QSLASAAHLSSFTASLNASLHHSQSLRRNLGHPLAAAAAVAAVAQSQAVPNLQHTLEKSPVAQRT 255
            .|...:.||.. :..|||.                |.||:||..:...:.|              
Human   182 PSELLSGHLFP-SGLLNAQ----------------APAALAAHPKLFLLEN-------------- 215

  Fly   256 AQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSS--PGSASGGKPKTF 318
            |:.:||.|:.....:|....|..|.|.........|.:   :.:|.::..|  ||.::.||||.|
Human   216 AKLAGLAADKFPHPAPYPHKERLPAPLEQVLKENSALT---AERGGVKGHSKLPGGSADGKPKNF 277

  Fly   319 SCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAF 383
            :|..|||||||||||||||||||||||||||||||||||||||||||||||.||||||..|||||
Human   278 TCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAF 342

  Fly   384 NRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFH 448
            |||||||||.||||||||||||:||||||||||||||||||||||.|||.|||||||||||||||
Human   343 NRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFH 407

  Fly   449 MHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHEIGGDLDDLDMPPTYDRRREYTR 504
            |||||||||:||..|.||||||||||||:||||:..|        |.....::.||
Human   408 MHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVG--------PAAPSAKDLTR 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 139/167 (83%)
C2H2 Zn finger 320..340 CDD:275368 17/19 (89%)
zf-H2C2_2 332..357 CDD:290200 24/24 (100%)
zf-C2H2 346..368 CDD:278523 21/21 (100%)
C2H2 Zn finger 348..368 CDD:275368 19/19 (100%)
zf-H2C2_2 363..385 CDD:290200 18/21 (86%)
C2H2 Zn finger 376..396 CDD:275368 16/19 (84%)
zf-H2C2_2 389..413 CDD:290200 21/23 (91%)
C2H2 Zn finger 404..424 CDD:275368 18/19 (95%)
zf-H2C2_2 416..441 CDD:290200 22/24 (92%)
C2H2 Zn finger 432..452 CDD:275368 18/19 (95%)
C2H2 Zn finger 460..478 CDD:275368 14/17 (82%)
FEZF2NP_060478.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 3/7 (43%)
Engrailed homology 1 repressor. /evidence=ECO:0000250 27..42 6/14 (43%)
C2H2 Zn finger 279..299 CDD:275368 17/19 (89%)
COG5048 <289..>395 CDD:227381 98/105 (93%)
C2H2 Zn finger 307..327 CDD:275368 19/19 (100%)
C2H2 Zn finger 335..355 CDD:275368 16/19 (84%)
C2H2 Zn finger 363..383 CDD:275368 18/19 (95%)
SFP1 <385..441 CDD:227516 48/55 (87%)
C2H2 Zn finger 391..411 CDD:275368 18/19 (95%)
C2H2 Zn finger 419..437 CDD:275368 14/17 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10880
eggNOG 1 0.900 - - E33208_3BDUH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2003
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D267238at33208
OrthoFinder 1 1.000 - - FOG0003530
OrthoInspector 1 1.000 - - otm42295
orthoMCL 1 0.900 - - OOG6_108112
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3594
SonicParanoid 1 1.000 - - X2035
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.