DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and osr1

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001006079.1 Gene:osr1 / 450059 ZFINID:ZDB-GENE-070321-1 Length:264 Species:Danio rerio


Alignment Length:264 Identity:80/264 - (30%)
Similarity:106/264 - (40%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 APNQLMCAAAAAQYAALTAQQQSLASAAHLS---SFTASLNASLHHSQSLRRNLGHP-------- 223
            ||..|..:...|.|:.|.........|.|:.   ||:|.....||     :..||:|        
Zfish     8 APVPLHPSLQLANYSFLQTSNGLHLPADHMPSIYSFSALHAVHLH-----QWTLGYPPFTLPRCT 67

  Fly   224 -LAAAAAVAAVAQSQAVPNLQHTLEKSPVAQRTAQSSGLQANLKRKRSPQ-DQGEVTPPPASTAT 286
             ......|.|.....::|...|.::  |..|   :|||..:....|..|: |...:    |:.||
Zfish    68 FSKLPGLVDARFPLPSIPLFPHLVQ--PAKQ---ESSGPGSGASSKSKPRFDFANL----AAAAT 123

  Fly   287 ----------SATGARSRSPSPQGSIEDSSPGSASGGKP----------KTFSCLECGKVFNAHY 331
                      |......|||| .|.:.|.:..|:...||          |.|.|..||:.|...|
Zfish   124 QDDALKAEDLSTNNGHVRSPS-LGCLLDVAKLSSPERKPSRGRLPSKTKKEFVCKFCGRHFTKSY 187

  Fly   332 NLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIH 396
            ||..|...||..||:.|.:|.|.||:...|..|:.||:.|||.|||.|||.|.:|.||..|..:|
Zfish   188 NLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLH 252

  Fly   397 AGYK 400
            ...|
Zfish   253 MQVK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 47/116 (41%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 332..357 CDD:290200 11/24 (46%)
zf-C2H2 346..368 CDD:278523 7/21 (33%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
zf-H2C2_2 363..385 CDD:290200 13/21 (62%)
C2H2 Zn finger 376..396 CDD:275368 10/19 (53%)
zf-H2C2_2 389..413 CDD:290200 4/12 (33%)
C2H2 Zn finger 404..424 CDD:275368
zf-H2C2_2 416..441 CDD:290200
C2H2 Zn finger 432..452 CDD:275368
C2H2 Zn finger 460..478 CDD:275368
osr1NP_001006079.1 zf-C2H2 174..196 CDD:278523 9/21 (43%)
C2H2 Zn finger 176..196 CDD:275368 8/19 (42%)
zf-H2C2_2 188..213 CDD:290200 11/24 (46%)
C2H2 Zn finger 204..224 CDD:275368 7/19 (37%)
zf-H2C2_2 216..239 CDD:290200 13/22 (59%)
C2H2 Zn finger 232..252 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.