DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and CG12071

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster


Alignment Length:471 Identity:101/471 - (21%)
Similarity:154/471 - (32%) Gaps:126/471 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 ASLNASLHHSQSLRRNLGHPLAAAAAVAAVAQSQAVPNLQHTLEKSPVA--QRTAQSSGLQANLK 266
            |..||.|....::::.:        |.||:...|...:.|   :.||.|  ...:|::|   |::
  Fly     7 AQKNAYLEAHMAVQQQM--------AQAAIQFKQQQTSQQ---QNSPTANNNNNSQNNG---NMQ 57

  Fly   267 RKRSPQDQGE---------------VTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPK 316
            :::..|.|.:               :..|..|::..|..|...|..   ::.|...|...|.:  
  Fly    58 QQQQQQQQQQQQQQQQQQQQHYAATIKVPQISSSNVAAAAAGESTF---TVPDDGMGFEGGVR-- 117

  Fly   317 TFSCLECGKVFNAHYNLTRHMPVHTGARPFV-CKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCG 380
               .|:....::|...||.::| .....||. ..|.|.....||.|      ...::..:..:..
  Fly   118 ---VLQSLGTWSAAEQLTYNIP-KPNLIPFTEPYVEGGSMHPASRL------KALQQVQQASSGV 172

  Fly   381 KAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNL 445
            :..|.|.:.|         |.|.|..||||..:|.....|...|:|||.|.|.:|||||.:...|
  Fly   173 RKTNPSKSTN---------KAFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFARRDKL 228

  Fly   446 TFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHEIGGDLDDLDMPPTYDRRREYTRR----- 505
            ..||:......|.......|.. .|...||....             ||..|.::....:     
  Fly   229 VIHMNKFKHVTPTNIAPLGKRL-NNMVKKKEQPD-------------PPPEDNKQSLELQLQQQA 279

  Fly   506 -EPLASGYGQASGQLTPDSSSGSMSP-----------------------------PINVTTPPLS 540
             :..|......|.|..|.|..|.:.|                             .:.. .|...
  Fly   280 VQVAAQNIIVQSAQGAPTSIPGIIIPHHQQQLSWTCELCGRMFSSRDEWSIHAKSHLEYXQPERL 344

  Fly   541 SGETSNPAWPRSAV----------SQYPPGGFHHQLG----------VAPPHDYPSGSAFLQLQP 585
            ..|::.||...:.|          ..|......:|:.          :.......:.|...|.||
  Fly   345 VAESTKPAAAAAGVIAKTTSSNNSRNYQMDANQNQIQMEAQARKQKIIIQNQMILNASHQQQQQP 409

  Fly   586 QQPHPQSQQHHQQQQR 601
            || |||.|||.||||:
  Fly   410 QQ-HPQQQQHQQQQQQ 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 43/166 (26%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 332..357 CDD:290200 7/25 (28%)
zf-C2H2 346..368 CDD:278523 6/22 (27%)
C2H2 Zn finger 348..368 CDD:275368 5/19 (26%)
zf-H2C2_2 363..385 CDD:290200 0/21 (0%)
C2H2 Zn finger 376..396 CDD:275368 3/19 (16%)
zf-H2C2_2 389..413 CDD:290200 8/23 (35%)
C2H2 Zn finger 404..424 CDD:275368 7/19 (37%)
zf-H2C2_2 416..441 CDD:290200 12/24 (50%)
C2H2 Zn finger 432..452 CDD:275368 9/19 (47%)
C2H2 Zn finger 460..478 CDD:275368 4/17 (24%)
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 8/21 (38%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
zf-H2C2_2 200..224 CDD:290200 12/23 (52%)
C2H2 Zn finger 215..232 CDD:275368 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.