DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and hb

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster


Alignment Length:716 Identity:151/716 - (21%)
Similarity:215/716 - (30%) Gaps:219/716 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QSPSTVNYD----------SAFKKYVPGPCSGATSSVASP-----PSTAAVQQFVSSRHQELLSQ 163
            ::.:|.||:          :|..|..||......|..:||     |||..::||:..:.|:|..|
  Fly     5 ETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIPSTNHLEQFLKQQQQQLQQQ 69

  Fly   164 YPLLYYAPNQLMCAAA---------AAQYAALTAQQQSLASAAHLSSFTASLNASLHHSQSL--- 216
                   |...:||..         :.|:.....|||.|....:...|.|:.....||...:   
  Fly    70 -------PMDTLCAMTPSPSQNDQNSLQHYDANLQQQLLQQQQYQQHFQAAQQQHHHHHHLMGGF 127

  Fly   217 ----RRNLGHPLAAAAAVAAVAQSQAVPNLQHTLEKSPVAQRTAQSSGLQANLKRKRSPQDQGEV 277
                ...|.:|:............|..|....|:  :|||..|..|..|||    ...|.|   |
  Fly   128 NPLTPPGLPNPMQHFYGGNLRPSPQPTPTSASTI--APVAVATGSSEKLQA----LTPPMD---V 183

  Fly   278 TPP--PASTATSATGARSRSPSPQGSIEDSS--------------PGSASGGKPKTFSCLECGKV 326
            |||  ||.::.|.............|.||..              |...|.||.|.:.|..||.|
  Fly   184 TPPKSPAKSSQSNIEPEKEHDQMSNSSEDMKYMAESEDDDTNIRMPIYNSHGKMKNYKCKTCGVV 248

  Fly   327 FNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHK---CQTCGKAFNRSST 388
            .....:...|...|.                              ||.|   |..|.........
  Fly   249 AITKVDFWAHTRTHM------------------------------KPDKILQCPKCPFVTEFKHH 283

  Fly   389 LNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHN 453
            |..|.|.|...|||.|:.|......|....:|:.:||....|:|..|:                 
  Fly   284 LEYHIRKHKNQKPFQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADCD----------------- 331

  Fly   454 DKKPYTCRVCAKGFCRNFDLKKHMRKL-HEIGGDLDDLDMP------PTYDRRREYTRRE--PLA 509
                     .|..:|.:|  |.|:||. |:.|..||:...|      ..|..||....:.  |:|
  Fly   332 ---------YATKYCHSF--KLHLRKYGHKPGMVLDEDGTPNPSLVIDVYGTRRGPKSKNGGPIA 385

  Fly   510 SGYGQASGQ-------LTPDSSSGSMSPPINV----------------TTPPLSSGETSNPAWPR 551
            || |..||.       :.|.......:.|:..                :.||.:|.....||.|.
  Fly   386 SG-GSGSGSRKSNVAAVAPQQQQSQPAQPVATSQLSAALQGFPLVQGNSAPPAASPVLPLPASPA 449

  Fly   552 SAVSQ-----------------------------YPPGGFHHQLGVAPPHDYPSGSAFLQLQPQQ 587
            .:|:.                             :|....:.|:..|    ....:...||.|:.
  Fly   450 KSVASVEQTPSLPSPANLLPPLASLLQQNRNMAFFPYWNLNLQMLAA----QQQAAVLAQLSPRM 510

  Fly   588 PHPQSQQHHQQQQRLSETFIAKVFXQRYYAESLNSSTGS--------------TSTTSSTVTTTT 638
             ..|.||.:|||....|......: ::....:::.|.|:              .:.........|
  Fly   511 -REQLQQQNQQQSDNEEEEQDDEYERKSVDSAMDLSQGTPVKEDEQQQQPQQPLAMNLKVEEEAT 574

  Fly   639 TAISSMATSRSD---LLIDXLQFVAAAAAASSSN-----------SGQDTGESPSPELGCTALGS 689
            ..:||...||..   |.:| |..:.:.|..|...           |....|..|.||..|:...|
  Fly   575 PLMSSSNASRRKGRVLKLDTLLQLRSEAMTSPEQLKVPSTPMPTASSPIAGRKPMPEEHCSGTSS 639

  Fly   690 A 690
            |
  Fly   640 A 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 35/182 (19%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 332..357 CDD:290200 2/24 (8%)
zf-C2H2 346..368 CDD:278523 0/21 (0%)
C2H2 Zn finger 348..368 CDD:275368 0/19 (0%)
zf-H2C2_2 363..385 CDD:290200 5/24 (21%)
C2H2 Zn finger 376..396 CDD:275368 5/19 (26%)
zf-H2C2_2 389..413 CDD:290200 9/23 (39%)
C2H2 Zn finger 404..424 CDD:275368 4/19 (21%)
zf-H2C2_2 416..441 CDD:290200 6/24 (25%)
C2H2 Zn finger 432..452 CDD:275368 2/19 (11%)
C2H2 Zn finger 460..478 CDD:275368 5/17 (29%)
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 5/19 (26%)
C2H2 Zn finger 271..291 CDD:275368 5/19 (26%)
zf-H2C2_2 283..308 CDD:290200 9/24 (38%)
C2H2 Zn finger 299..319 CDD:275368 4/19 (21%)
C2H2 Zn finger 327..345 CDD:275368 7/45 (16%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.