DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and CG11247

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster


Alignment Length:338 Identity:83/338 - (24%)
Similarity:113/338 - (33%) Gaps:124/338 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 KRKRSPQDQGEVTPPPASTATSATGARSRSPSP------------------------QGSIEDSS 306
            :|..|.:|...:......:.:|...||..||.|                        .|..:||.
  Fly     5 RRSVSKEDAVSLLTDSGISLSSPPAARESSPGPTLAIKRRKSSLASLRDACVDEEEDDGGEQDSK 69

  Fly   307 PG---------SASGGKP---KTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQAS 359
            ..         ||..|:|   |...|.:|.|.|....:|.|||.:|:..||..||.|||.:|||.
  Fly    70 DDDYVQPQLKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAV 134

  Fly   360 TLCRH-KIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGF------------ 411
            .|..| ...|...|...|..|.|:|.....|..|.|:|:|.||:.|:.|.|.|            
  Fly   135 NLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVS 199

  Fly   412 ------------------------------HQKG----------------------NYKNHKLT- 423
                                          |::|                      |.::|||| 
  Fly   200 HHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQ 264

  Fly   424 ----------------------HSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKG 466
                                  |:..|.:.|.:||..|.|......||..|..::||.||:|.:.
  Fly   265 FECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQT 329

  Fly   467 FCRNFDLKKHMRK 479
            |..:..||.|:||
  Fly   330 FAHSSVLKLHIRK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 68/289 (24%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 332..357 CDD:290200 12/24 (50%)
zf-C2H2 346..368 CDD:278523 10/22 (45%)
C2H2 Zn finger 348..368 CDD:275368 10/20 (50%)
zf-H2C2_2 363..385 CDD:290200 7/22 (32%)
C2H2 Zn finger 376..396 CDD:275368 7/19 (37%)
zf-H2C2_2 389..413 CDD:290200 11/65 (17%)
C2H2 Zn finger 404..424 CDD:275368 11/106 (10%)
zf-H2C2_2 416..441 CDD:290200 11/47 (23%)
C2H2 Zn finger 432..452 CDD:275368 7/19 (37%)
C2H2 Zn finger 460..478 CDD:275368 7/17 (41%)
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 41/158 (26%)
C2H2 Zn finger 95..115 CDD:275368 8/19 (42%)
zf-H2C2_2 107..132 CDD:290200 12/24 (50%)
C2H2 Zn finger 123..144 CDD:275368 10/20 (50%)
C2H2 Zn finger 152..172 CDD:275368 7/19 (37%)
zf-H2C2_2 165..189 CDD:290200 11/23 (48%)
C2H2 Zn finger 180..200 CDD:275368 4/19 (21%)
COG5048 <192..369 CDD:227381 28/151 (19%)
C2H2 Zn finger 210..230 CDD:275370 0/19 (0%)
C2H2 Zn finger 238..260 CDD:275371 1/21 (5%)
C2H2 Zn finger 267..287 CDD:275368 0/19 (0%)
C2H2 Zn finger 295..315 CDD:275368 7/19 (37%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
C2H2 Zn finger 323..343 CDD:275368 9/20 (45%)
C2H2 Zn finger 351..374 CDD:275368
C2H2 Zn finger 382..399 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.