DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment erm and ZK686.5

DIOPT Version :9

Sequence 1:	NP_001259891.2	Gene:	erm / 326152	FlyBaseID:	FBgn0031375	Length:	698	Species:	Drosophila melanogaster
Sequence 2:	NP_001023030.2	Gene:	ZK686.5 / 3565160	WormBaseID:	WBGene00022795	Length:	263	Species:	Caenorhabditis elegans

Alignment Length:	87	Identity:	26/87 - (29%)
Similarity:	46/87 - (52%)	Gaps:	9/87 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   348 CKVCGKGFRQASTLCRHK-IIHTSEKPH-KCQTCGKAFNRSSTLNTHSRIHAG--YKPFV-CEYC 407
            |::|.:.|..:..|..|: .:|.:  |: :|..|.|.|:::...|.|.:.|.|  .|.:| ||.|
Worm   173 CELCEQNFSSSKMLLLHRGKVHNT--PYIECHLCMKLFSQTIQFNRHMKTHYGPNAKIYVQCELC 235

  Fly   408 GKGFHQKGNYKNH-KLTH-SGE 427
            .:.|..|.:.:.| .::| ||:
Worm   236 DRQFKDKQSLRTHWDVSHGSGD 257

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
erm	NP_001259891.2	COG5048	<295..461	CDD:227381	26/87 (30%)
		C2H2 Zn finger	320..340	CDD:275368
		zf-H2C2_2	332..357	CDD:290200	3/8 (38%)
		zf-C2H2	346..368	CDD:278523	5/20 (25%)
		C2H2 Zn finger	348..368	CDD:275368	5/20 (25%)
		zf-H2C2_2	363..385	CDD:290200	7/23 (30%)
		C2H2 Zn finger	376..396	CDD:275368	6/19 (32%)
		zf-H2C2_2	389..413	CDD:290200	10/26 (38%)
		C2H2 Zn finger	404..424	CDD:275368	6/20 (30%)
		zf-H2C2_2	416..441	CDD:290200	4/14 (29%)
		C2H2 Zn finger	432..452	CDD:275368
		C2H2 Zn finger	460..478	CDD:275368
ZK686.5	NP_001023030.2	C2H2 Zn finger	173..194	CDD:275368	5/20 (25%)
		C2H2 Zn finger	201..221	CDD:275368	6/19 (32%)
		zf-C2H2_8	<204..251	CDD:292531	15/46 (33%)
		C2H2 Zn finger	232..248	CDD:275368	5/15 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000