DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and CG17328

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:439 Identity:107/439 - (24%)
Similarity:156/439 - (35%) Gaps:130/439 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LNASLHHSQS-------LRRNLGHPLAAAAAVAAVAQSQAVPNLQHTLEKSPVAQRTA-QSSGLQ 262
            |..:.|..|.       ||:.||        :....:..|..|... :||..:.||.: :...:.
  Fly    61 LGVAFHFKQECENSDLRLRQYLG--------ILESWRQDAATNTDF-VEKPLLPQRDSDEEEPVD 116

  Fly   263 ANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPK-TFSCLECGKV 326
            |.:.::||...:    .||..       .:.|.|.|               .|| ..:|.||.|.
  Fly   117 AKVSKRRSRYQR----KPPEE-------HKKRGPKP---------------VPKMPHTCYECHKS 155

  Fly   327 FNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNT 391
            |.....||:|:..|||.:|:.|..|.:.|.|...|..|:..||.:||.:|:.|.|.|:.......
  Fly   156 FKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQA 220

  Fly   392 HSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFH---MH--- 450
            |.:||.|.:..||..|.|||:..|:...|.:||:|.|.:.|::|.|||.:..::..|   :|   
  Fly   221 HQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLE 285

  Fly   451 ---THN--------------------DKKPYTCRVCAKGFCRNFDLKKHMRKLHEIGGDLDDLDM 492
               .|:                    |...:.|..|.|.|.....|..|.| .|....:|.:|.:
  Fly   286 SSTNHDIVDDDDDEAIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFR-THAANNNLLNLPL 349

  Fly   493 PPTYDRRREYTRREPLASGYGQASGQLTPDSSSGSMSPPINVTTPPLSSGETSNPAWPRSAVSQY 557
            ||.          .|::..|..        .:...:.||              |||      :|.
  Fly   350 PPA----------PPMSHHYHH--------DALHHLGPP--------------NPA------TQM 376

  Fly   558 PPGGFHHQLGVAPPHDYPSGSAFLQLQPQQPHPQ----SQQHHQQQQRL 602
            ......|.|  |||            .|..|.|.    :..||...|||
  Fly   377 GMAAMAHML--APP------------PPPPPTPSEGRYTMLHHTAAQRL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 55/195 (28%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 332..357 CDD:290200 10/24 (42%)
zf-C2H2 346..368 CDD:278523 6/21 (29%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
zf-H2C2_2 363..385 CDD:290200 9/21 (43%)
C2H2 Zn finger 376..396 CDD:275368 5/19 (26%)
zf-H2C2_2 389..413 CDD:290200 10/23 (43%)
C2H2 Zn finger 404..424 CDD:275368 7/19 (37%)
zf-H2C2_2 416..441 CDD:290200 10/24 (42%)
C2H2 Zn finger 432..452 CDD:275368 7/28 (25%)
C2H2 Zn finger 460..478 CDD:275368 6/17 (35%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 4/18 (22%)
COG5048 146..>211 CDD:227381 24/64 (38%)
C2H2 Zn finger 149..169 CDD:275368 8/19 (42%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
zf-H2C2_2 189..213 CDD:404364 9/23 (39%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
zf-H2C2_2 245..270 CDD:404364 10/24 (42%)
C2H2 Zn finger 261..282 CDD:275368 6/20 (30%)
C2H2 Zn finger 318..338 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.