DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and Zfp446

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_780767.1 Gene:Zfp446 / 269870 MGIID:2442185 Length:523 Species:Mus musculus


Alignment Length:446 Identity:89/446 - (19%)
Similarity:148/446 - (33%) Gaps:136/446 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RGMQPCSP-------------AGEIA------MMPPSKSPVMESAASEQNPAQQSQQQDEQSAKR 52
            ||.:|.||             .|::.      ::.|...|:::..:|..:....:.:..:.....
Mouse   187 RGQRPGSPEEAAVLVEGLQHDPGQLLGWITAHILKPKMLPLVQKESSGSHHISAATESSKAGLAE 251

  Fly    53 ACPLKFSIAKIMEPDHRPSQVPPPQPAPVSFATNDDDEDEDPEIDADSERSCSPIEVISLDQSPS 117
            | |||..|       .|.:|        :|.:..:       |:.||.:...||..::|...|..
Mouse   252 A-PLKAGI-------DRSTQ--------ISCSVKE-------EVSADGQEMVSPSALLSTQDSEG 293

  Fly   118 TVNYDSAFKKYVPGPCSGATSSVASPPSTAAVQQFVSSRHQELLSQYPLLYYAPNQLMCAAAAAQ 182
            .:.:..             |.|::          |.:.|.||    :.||..:..:|.......:
Mouse   294 HLEHQE-------------TVSIS----------FQTGRIQE----WGLLDSSQKELCWGVMPEK 331

  Fly   183 YAALTAQQQ--SLASAAHLSSFTASLNASLHHS-QSLRRNLGHPLAAAAAVAAVAQSQAVPNLQH 244
            |..:.:|..  .|....|:.|.........|.. :|||   .||    ..|.|:|..:.|     
Mouse   332 YDTVVSQASLPLLQPETHVDSELRPKQEMPHEGPESLR---SHP----PEVGAIADPRLV----- 384

  Fly   245 TLEKSPVAQRTAQSSGLQANLKRKRSP-QDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPG 308
                             ||....::|| :|...::|.|...|.:       .|:|:         
Mouse   385 -----------------QATPSERQSPCKDPSVLSPTPLLEAPA-------RPTPR--------- 416

  Fly   309 SASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSE-- 371
                   |.:.|.:||..|:.......|:..||.         |.|..:.|.:.|...:..|.  
Mouse   417 -------KLYVCEQCGLSFDWKSVFIIHLRTHTR---------GPGLERPSQVAREPAMKRSPGL 465

  Fly   372 KPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGE 427
            :.:.|..||::|:..|.|..|.:.|||.:...|..||..|..|.....|:..|..|
Mouse   466 RGYTCVECGRSFSWKSQLVIHRKSHAGQRRHFCRDCGCSFDWKFQLVIHRKIHQPE 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 33/135 (24%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 332..357 CDD:290200 5/24 (21%)
zf-C2H2 346..368 CDD:278523 4/21 (19%)
C2H2 Zn finger 348..368 CDD:275368 4/19 (21%)
zf-H2C2_2 363..385 CDD:290200 6/23 (26%)
C2H2 Zn finger 376..396 CDD:275368 7/19 (37%)
zf-H2C2_2 389..413 CDD:290200 9/23 (39%)
C2H2 Zn finger 404..424 CDD:275368 6/19 (32%)
zf-H2C2_2 416..441 CDD:290200 3/12 (25%)
C2H2 Zn finger 432..452 CDD:275368
C2H2 Zn finger 460..478 CDD:275368
Zfp446NP_780767.1 SCAN 122..226 CDD:128708 7/38 (18%)
SCAN 122..210 CDD:280241 5/22 (23%)
KRAB_A-box 301..338 CDD:143639 9/50 (18%)
C2H2 Zn finger 421..441 CDD:275368 5/19 (26%)
ZnF_C2H2 468..490 CDD:197676 7/21 (33%)
C2H2 Zn finger 470..490 CDD:275368 7/19 (37%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.