Sequence 1: | NP_001259891.2 | Gene: | erm / 326152 | FlyBaseID: | FBgn0031375 | Length: | 698 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035989.1 | Gene: | Osr1 / 23967 | MGIID: | 1344424 | Length: | 266 | Species: | Mus musculus |
Alignment Length: | 233 | Identity: | 77/233 - (33%) |
---|---|---|---|
Similarity: | 97/233 - (41%) | Gaps: | 44/233 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 SLASAAHLSSFTASLNASLHHSQSLRRNLGHPLAAAAAVAAVAQSQAVPNLQHTLEKSPVAQRTA 256
Fly 257 QSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGG-------- 313
Fly 314 ------KP----------KTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLC 362
Fly 363 RHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYK 400 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
erm | NP_001259891.2 | COG5048 | <295..461 | CDD:227381 | 49/130 (38%) |
C2H2 Zn finger | 320..340 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 332..357 | CDD:290200 | 11/24 (46%) | ||
zf-C2H2 | 346..368 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 348..368 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 363..385 | CDD:290200 | 13/21 (62%) | ||
C2H2 Zn finger | 376..396 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 389..413 | CDD:290200 | 4/12 (33%) | ||
C2H2 Zn finger | 404..424 | CDD:275368 | |||
zf-H2C2_2 | 416..441 | CDD:290200 | |||
C2H2 Zn finger | 432..452 | CDD:275368 | |||
C2H2 Zn finger | 460..478 | CDD:275368 | |||
Osr1 | NP_035989.1 | zf-C2H2 | 175..197 | CDD:395048 | 9/21 (43%) |
C2H2 Zn finger | 177..197 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 189..214 | CDD:404364 | 11/24 (46%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 217..240 | CDD:404364 | 13/22 (59%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 10/19 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |