DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and Y111B2A.10

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_499640.1 Gene:Y111B2A.10 / 176678 WormBaseID:WBGene00013734 Length:430 Species:Caenorhabditis elegans


Alignment Length:440 Identity:83/440 - (18%)
Similarity:133/440 - (30%) Gaps:156/440 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 YPLLYYAPNQLMCAAAAAQYAALTAQQQSLASAAHLSSFTASLNASLHHSQSLRRNLGHPLAAAA 228
            ||:.|            |....:|:...|..|.|..::|:.. |.:::..|.|...|...     
 Worm     6 YPMSY------------ADLTPVTSCSSSSNSEADANNFSTK-NKNVNEFQKLIEELEFE----- 52

  Fly   229 AVAAVAQSQAVPNLQHTLE-----------KSPVAQRTAQSSGLQANLKRKRSPQDQGEVTPPPA 282
                 .:.:.||.:...:|           |.|..::.|... ||..::|:.:  |.|:......
 Worm    53 -----PEDRRVPEVAEEVESEDEEEEDVQIKYPYERKDAYQD-LQERIERRLN--DSGDEKLEQK 109

  Fly   283 STATSATGARSRSPSPQGSIEDSSPGSASGGKPKT----FSCLECGKVF-NAHYNLTRHMPVHTG 342
            :....:....|:|   |..:|.......|..||.|    |:|:.|.|.| ||.........||..
 Worm   110 AKELQSLIRMSQS---QWKVEQKQQLEDSLLKPHTAGSIFTCVMCSKAFPNAEALQIHTDQVHDL 171

  Fly   343 AR-PFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIH---------- 396
            :| ...||:|||.:::...|..|..:|..|  .:|..|...|....:|.:|...|          
 Worm   172 SRLKHRCKLCGKAYKRKKNLDAHMALHLKE--IQCDNCSLVFQSEKSLQSHIIRHHQEDADELEV 234

  Fly   397 ----------------------------------------------------------------- 396
                                                                             
 Worm   235 WKAPCSICKELFPSTSVKTHEWYCKNREKIIEKQRVSKILKVQSLPSSPALSTVSYASFSSCQPG 299

  Fly   397 -----AGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEK-----------------------AYKCN 433
                 ..|:...|:.||:.|..    :...|.|.|.|                       .|.|.
 Worm   300 PITSPVSYRDKSCQVCGESFAS----RQSMLRHVGRKHPDAKNDPNVTAVRYISAESPKHPYACI 360

  Fly   434 ICNKAFHQVYNLTFH-MHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHE 482
            .|.|.|..|..|:.| ...|:....:.|.:|.|.:....:|:||::::||
 Worm   361 ECGKRFTTVTALSTHKARVHSQSNRFECTICHKSYPVPSELRKHIKRVHE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 50/275 (18%)
C2H2 Zn finger 320..340 CDD:275368 6/20 (30%)
zf-H2C2_2 332..357 CDD:290200 8/25 (32%)
zf-C2H2 346..368 CDD:278523 7/21 (33%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
zf-H2C2_2 363..385 CDD:290200 6/21 (29%)
C2H2 Zn finger 376..396 CDD:275368 5/19 (26%)
zf-H2C2_2 389..413 CDD:290200 8/103 (8%)
C2H2 Zn finger 404..424 CDD:275368 5/19 (26%)
zf-H2C2_2 416..441 CDD:290200 9/47 (19%)
C2H2 Zn finger 432..452 CDD:275368 7/20 (35%)
C2H2 Zn finger 460..478 CDD:275368 6/17 (35%)
Y111B2A.10NP_499640.1 C2H2 Zn finger 148..169 CDD:275368 6/20 (30%)
zf-C2H2_8 151..221 CDD:292531 21/71 (30%)
C2H2 Zn finger 178..198 CDD:275368 7/19 (37%)
C2H2 Zn finger 204..224 CDD:275368 5/19 (26%)
C2H2 Zn finger 312..333 CDD:275368 7/24 (29%)
C2H2 Zn finger 359..380 CDD:275368 7/20 (35%)
C2H2 Zn finger 388..409 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.