DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and ztf-6

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_492877.1 Gene:ztf-6 / 173014 WormBaseID:WBGene00012317 Length:480 Species:Caenorhabditis elegans


Alignment Length:359 Identity:86/359 - (23%)
Similarity:132/359 - (36%) Gaps:63/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HRPSQVPPPQPAPVSFATNDDDEDEDPEIDADSERSCSPIEVISL--DQSPSTV----NYDSAFK 126
            ||.|:.||.:....:...:||:|.|...|::.|.||.|.....|.  |::..|:    :......
 Worm   105 HRSSEEPPRRKPSAAGGDHDDEELECSSIESRSIRSVSSSVHTSAEDDETNQTMMVPTDVADVIN 169

  Fly   127 KYVPG----PCSGATSSVASP------------------PSTAAVQQFVSSRHQELLSQYPLLYY 169
            ..|.|    ..|..|||..||                  .||:..:..:|.:.:..|....||  
 Worm   170 AIVAGTNGSSNSNTTSSSKSPQEEEEEHDLVMKSILSTTTSTSNTKLELSEKLENPLQDTALL-- 232

  Fly   170 APNQLMCAAAAAQYAALT----AQQQSLASAAHLSSFTASLNASLHHSQSLRRNLGHPLAAAAAV 230
              :|.:.|:...|...:|    ..::.....|.|:||...|.|:.....::       |.|.::.
 Worm   233 --DQFLQASLLGQTPTVTPASEENEEDKEQNAVLTSFLQILFANQQAGNAI-------LDAGSSE 288

  Fly   231 AAVAQSQAVPNLQHTLEKSPVAQRTAQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRS 295
            ...:.|.:.|        ||.|..||....| |..:...:....|.|.....|:|.....||.|.
 Worm   289 NDGSTSSSQP--------SPPADPTASLDSL-AMFESLLAESMNGNVLDANTSSADQKAAARKRK 344

  Fly   296 PSPQGSIEDSSPGSASGGKPKTFSCL--ECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQA 358
            .:|.     ..|.|.:|.   .:.|.  .|.|||....::.||...|.|.| |.|..|...:.|.
 Worm   345 STPM-----KVPKSENGA---GYICPMDGCNKVFKEKGSVHRHFVTHIGMR-FNCDKCKASYTQK 400

  Fly   359 STLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTH 392
            ..|..|:.||.:...::|:.||..:...:.|..|
 Worm   401 HALMLHQKIHANPDAYQCRGCGTNYTTQNGLRLH 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 27/100 (27%)
C2H2 Zn finger 320..340 CDD:275368 7/21 (33%)
zf-H2C2_2 332..357 CDD:290200 8/24 (33%)
zf-C2H2 346..368 CDD:278523 6/21 (29%)
C2H2 Zn finger 348..368 CDD:275368 5/19 (26%)
zf-H2C2_2 363..385 CDD:290200 6/21 (29%)
C2H2 Zn finger 376..396 CDD:275368 5/17 (29%)
zf-H2C2_2 389..413 CDD:290200 2/4 (50%)
C2H2 Zn finger 404..424 CDD:275368
zf-H2C2_2 416..441 CDD:290200
C2H2 Zn finger 432..452 CDD:275368
C2H2 Zn finger 460..478 CDD:275368
ztf-6NP_492877.1 zf-C2H2_8 361..434 CDD:292531 22/73 (30%)
C2H2 Zn finger 361..383 CDD:275368 7/21 (33%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
C2H2 Zn finger 418..435 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4043
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.