| Sequence 1: | NP_001259891.2 | Gene: | erm / 326152 | FlyBaseID: | FBgn0031375 | Length: | 698 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_573467.2 | Gene: | Zscan5b / 170734 | MGIID: | 2159640 | Length: | 468 | Species: | Mus musculus |
| Alignment Length: | 252 | Identity: | 91/252 - (36%) |
|---|---|---|---|
| Similarity: | 108/252 - (42%) | Gaps: | 46/252 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 225 AAAAAVAAVAQSQ------AVPNLQHTLEKSPVAQRTAQS-SGLQANLKRKRSPQDQG------- 275
Fly 276 ------EVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLECGKVFNAHYNLT 334
Fly 335 RHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGY 399
Fly 400 KPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKK 456 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| erm | NP_001259891.2 | COG5048 | <295..461 | CDD:227381 | 68/162 (42%) |
| C2H2 Zn finger | 320..340 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 332..357 | CDD:290200 | 11/24 (46%) | ||
| zf-C2H2 | 346..368 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 348..368 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 363..385 | CDD:290200 | 10/21 (48%) | ||
| C2H2 Zn finger | 376..396 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 389..413 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 404..424 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 416..441 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 432..452 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 460..478 | CDD:275368 | |||
| Zscan5b | NP_573467.2 | SCAN | 33..117 | CDD:153421 | |
| C2H2 Zn finger | 328..348 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 344..365 | CDD:372612 | 11/20 (55%) | ||
| C2H2 Zn finger | 356..376 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 368..393 | CDD:372612 | 11/24 (46%) | ||
| C2H2 Zn finger | 384..404 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 397..419 | CDD:372612 | 12/21 (57%) | ||
| zf-C2H2 | 410..432 | CDD:333835 | 10/21 (48%) | ||
| C2H2 Zn finger | 412..432 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2 | 438..460 | CDD:333835 | 9/21 (43%) | ||
| C2H2 Zn finger | 440..460 | CDD:275370 | 8/19 (42%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||