DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and OSR1

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_660303.1 Gene:OSR1 / 130497 HGNCID:8111 Length:266 Species:Homo sapiens


Alignment Length:233 Identity:75/233 - (32%)
Similarity:95/233 - (40%) Gaps:44/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SLASAAHLSSFTASLNASLHHSQSLRRNLGHPLAAAAAVAAVAQSQAVPNLQHTLEKSPVAQRTA 256
            |...|.||..:|....| :|..:|....:  |...::.|.|..|..|.|...|.::..|  :.||
Human    45 SALHAVHLHQWTLGYPA-MHLPRSSFSKV--PGTVSSLVDARFQLPAFPWFPHVIQPKP--EITA 104

  Fly   257 QSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGG-------- 313
              .|....||           |.|....|..|..|....|:..|..|  .|||.:||        
Human   105 --GGSVPALK-----------TKPRFDFANLALAATQEDPAKLGRGE--GPGSPAGGLGALLDVT 154

  Fly   314 ------KP----------KTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLC 362
                  ||          |.|.|..||:.|...|||..|...||..||:.|.:|.|.||:...|.
Human   155 KLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLR 219

  Fly   363 RHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYK 400
            .|:.||:.|||.|||.|||.|.:|.||..|..:|:..|
Human   220 DHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 49/130 (38%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 332..357 CDD:290200 11/24 (46%)
zf-C2H2 346..368 CDD:278523 7/21 (33%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
zf-H2C2_2 363..385 CDD:290200 13/21 (62%)
C2H2 Zn finger 376..396 CDD:275368 10/19 (53%)
zf-H2C2_2 389..413 CDD:290200 4/12 (33%)
C2H2 Zn finger 404..424 CDD:275368
zf-H2C2_2 416..441 CDD:290200
C2H2 Zn finger 432..452 CDD:275368
C2H2 Zn finger 460..478 CDD:275368
OSR1NP_660303.1 zf-C2H2 175..197 CDD:306579 9/21 (43%)
C2H2 Zn finger 177..197 CDD:275368 8/19 (42%)
zf-H2C2_2 189..214 CDD:316026 11/24 (46%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
zf-H2C2_2 217..240 CDD:316026 13/22 (59%)
C2H2 Zn finger 233..253 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.