Sequence 1: | NP_001259891.2 | Gene: | erm / 326152 | FlyBaseID: | FBgn0031375 | Length: | 698 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031747399.1 | Gene: | zbtb25 / 100496704 | XenbaseID: | XB-GENE-958947 | Length: | 474 | Species: | Xenopus tropicalis |
Alignment Length: | 285 | Identity: | 53/285 - (18%) |
---|---|---|---|
Similarity: | 80/285 - (28%) | Gaps: | 127/285 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 222 HP---LAAAAAVAAVAQSQAVPNLQHTLEKSPVAQRTAQSSGL-----QANLKRKRSPQDQGEVT 278
Fly 279 PPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTG- 342
Fly 343 ------------------ARPFV------------------------------------------ 347
Fly 348 --------------------CKVCGKGFRQASTLCRHKIIHTSEKPHK---CQTCGKAFNR---- 385
Fly 386 -SSTL--NTHSRIHAG--YKPFVCE 405 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
erm | NP_001259891.2 | COG5048 | <295..461 | CDD:227381 | 36/204 (18%) |
C2H2 Zn finger | 320..340 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 332..357 | CDD:290200 | 9/105 (9%) | ||
zf-C2H2 | 346..368 | CDD:278523 | 7/83 (8%) | ||
C2H2 Zn finger | 348..368 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 363..385 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 376..396 | CDD:275368 | 8/26 (31%) | ||
zf-H2C2_2 | 389..413 | CDD:290200 | 8/21 (38%) | ||
C2H2 Zn finger | 404..424 | CDD:275368 | 1/2 (50%) | ||
zf-H2C2_2 | 416..441 | CDD:290200 | |||
C2H2 Zn finger | 432..452 | CDD:275368 | |||
C2H2 Zn finger | 460..478 | CDD:275368 | |||
zbtb25 | XP_031747399.1 | BTB_POZ | 41..168 | CDD:365784 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |