DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and zbtb25

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_031747399.1 Gene:zbtb25 / 100496704 XenbaseID:XB-GENE-958947 Length:474 Species:Xenopus tropicalis


Alignment Length:285 Identity:53/285 - (18%)
Similarity:80/285 - (28%) Gaps:127/285 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 HP---LAAAAAVAAVAQSQAVPNLQHTLEKSPVAQRTAQSSGL-----QANLKRKRSPQDQGEVT 278
            ||   |:.|..:..|:|.|...:....::.|..:....|.:.:     :.:.:..||||.     
 Frog   200 HPQLQLSLAIGLEGVSQEQQSSHFPAQVDTSVKSLEEFQKTTVSIKEEKCDSEASRSPQQ----- 259

  Fly   279 PPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTG- 342
            |.|......:|.|::.:                    ||.||..||:.|.:...|..|:.:|.. 
 Frog   260 PFPPLEGEESTFAKTAN--------------------KTHSCHYCGETFESRVILRDHLHIHVSE 304

  Fly   343 ------------------ARPFV------------------------------------------ 347
                              .||.:                                          
 Frog   305 SLPFGVPASILESDDLGEVRPILENIENTESYRLGNILVNKSEESSQNSSHQEQLQLNQLSFLSK 369

  Fly   348 --------------------CKVCGKGFRQASTLCRHKIIHTSEKPHK---CQTCGKAFNR---- 385
                                |.:||..|.:.|.|..|...| ..||||   .|..|...::    
 Frog   370 EADPIELNCNFSLLRKRKLSCTLCGHRFLRRSQLLEHLYAH-KMKPHKYGRYQRIGNQIDQTLQT 433

  Fly   386 -SSTL--NTHSRIHAG--YKPFVCE 405
             |.||  ||.|.:.|.  |..|:.|
 Frog   434 YSDTLTENTQSHLEASQDYPEFLEE 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 36/204 (18%)
C2H2 Zn finger 320..340 CDD:275368 6/19 (32%)
zf-H2C2_2 332..357 CDD:290200 9/105 (9%)
zf-C2H2 346..368 CDD:278523 7/83 (8%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
zf-H2C2_2 363..385 CDD:290200 8/24 (33%)
C2H2 Zn finger 376..396 CDD:275368 8/26 (31%)
zf-H2C2_2 389..413 CDD:290200 8/21 (38%)
C2H2 Zn finger 404..424 CDD:275368 1/2 (50%)
zf-H2C2_2 416..441 CDD:290200
C2H2 Zn finger 432..452 CDD:275368
C2H2 Zn finger 460..478 CDD:275368
zbtb25XP_031747399.1 BTB_POZ 41..168 CDD:365784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.