DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment erm and zbtb49

DIOPT Version :9

Sequence 1:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001076468.1 Gene:zbtb49 / 100009630 ZFINID:ZDB-GENE-070209-170 Length:524 Species:Danio rerio


Alignment Length:396 Identity:117/396 - (29%)
Similarity:166/396 - (41%) Gaps:85/396 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PEIDADSERSCSPIEVISLDQSPSTVNYDSAFKKYVPGPCSGATSSVASPPSTAAVQQFVSSRHQ 158
            |.:.|||..||..                ||..:.|.||  || |....||.|..::.|.|   :
Zfish   119 PCVSADSASSCCV----------------SAGPECVSGP--GA-SEPQEPPHTHKLRSFYS---R 161

  Fly   159 ELLSQYPLLYYAPN-----QLMCAAAAAQYAALTAQQQSLASAAHLSSFTASLNASLHHSQSLRR 218
            :.|.|.|....||:     |........::..|.:|::.....|.                    
Zfish   162 QYLQQSPAAGPAPSGPGAPQHKKTLYVKKFNYLRSQEEEEERCAG-------------------- 206

  Fly   219 NLGHPLAAAAAVAAVAQSQAVPN---LQHTLEKSP---VAQRTAQSSGLQANLKRKRSPQDQGEV 277
              ||   |....|..:.:...|:   :...|..:|   |....|:::.|:      |:|:.:   
Zfish   207 --GH---APCGPATPSSADTTPSDLCVTSDLCVTPDLCVTSDPAEAAELE------RTPEAE--- 257

  Fly   278 TPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTG 342
               |.:|            .|||..:.|   ..|||....:.|..|||.|....||..|...|||
Zfish   258 ---PGNT------------GPQGQEQRS---GVSGGGGNKYCCEVCGKTFKHPSNLELHKRSHTG 304

  Fly   343 ARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYC 407
            .:||.|.||||.|.||..|..|...|:.|||:.|:.|||:|..|..:..|..||:|.:|.:|:.|
Zfish   305 EKPFQCSVCGKAFSQAGNLQTHLRRHSGEKPYICELCGKSFAASGDVQRHIIIHSGARPHLCDVC 369

  Fly   408 GKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFD 472
            |:||....|.|.||.||..|:.:.|:.|.|:|:....|..|...|:..|||.|:.|.|.|..:.|
Zfish   370 GRGFSNFSNLKEHKKTHRAEREFTCDQCGKSFNMQRKLLKHKSRHSGDKPYCCQTCGKCFAGSGD 434

  Fly   473 LKKHMR 478
            |::|:|
Zfish   435 LQRHVR 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ermNP_001259891.2 COG5048 <295..461 CDD:227381 67/165 (41%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 332..357 CDD:290200 14/24 (58%)
zf-C2H2 346..368 CDD:278523 11/21 (52%)
C2H2 Zn finger 348..368 CDD:275368 10/19 (53%)
zf-H2C2_2 363..385 CDD:290200 10/21 (48%)
C2H2 Zn finger 376..396 CDD:275368 7/19 (37%)
zf-H2C2_2 389..413 CDD:290200 10/23 (43%)
C2H2 Zn finger 404..424 CDD:275368 9/19 (47%)
zf-H2C2_2 416..441 CDD:290200 11/24 (46%)
C2H2 Zn finger 432..452 CDD:275368 6/19 (32%)
C2H2 Zn finger 460..478 CDD:275368 7/17 (41%)
zbtb49NP_001076468.1 zf-H2C2_2 322..346 CDD:290200 10/23 (43%)
C2H2 Zn finger 338..358 CDD:275368 7/19 (37%)
C2H2 Zn finger 366..386 CDD:275368 9/19 (47%)
zf-H2C2_2 378..402 CDD:290200 10/23 (43%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
zf-H2C2_2 407..430 CDD:290200 9/22 (41%)
C2H2 Zn finger 422..442 CDD:275368 8/19 (42%)
zf-H2C2_2 434..459 CDD:290200 4/7 (57%)
C2H2 Zn finger 450..467 CDD:275368
BTB 15..118 CDD:279045
BTB 26..118 CDD:197585
zf-C2H2 280..302 CDD:278523 8/21 (38%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
COG5048 <292..466 CDD:227381 63/149 (42%)
zf-H2C2_2 294..319 CDD:290200 14/24 (58%)
C2H2 Zn finger 310..330 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.