DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant5 and Galntl5

DIOPT Version :9

Sequence 1:NP_001036338.1 Gene:Pgant5 / 326151 FlyBaseID:FBgn0031681 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_080725.2 Gene:Galntl5 / 67909 MGIID:1915159 Length:431 Species:Mus musculus


Alignment Length:337 Identity:155/337 - (45%)
Similarity:221/337 - (65%) Gaps:4/337 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 NLLASDMISLNRSLTDVRHEGCRRKHYASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLK 220
            |.:.|..:.:.|.:.|.|.:.|::|||...|||.||:|.|:||.:.||||.|.||:|.||:.||:
Mouse    84 NAIMSRRLGIEREVPDSRDKICQQKHYPFNLPTASIIICFYNEEFNTLLRAVSSVVNLSPQHLLE 148

  Fly   221 EIILVDDASERDFLGKQLEEYVAKLPVKTFVLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCEC 285
            |||||||.||.|.|..:|:.|:.....|..::|.:||.||||::::||...||:::.|||:|||.
Mouse   149 EIILVDDMSEFDDLKDKLDYYLEIFRGKVKLIRNKKREGLIRSKMIGASRASGDILVFLDSHCEV 213

  Fly   286 TEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASDSTWGGFNWKLNFRWYRVPSREMARRN 350
            ...||||||..|.::.:.|||||||||::.|.:|: |:....|.|:|.||.||..|.:.|:....
Mouse   214 NRVWLEPLLHAIAKDHKMVVCPIIDVINELTLDYM-AAPIVRGAFDWNLNLRWDNVFAYELDGPE 277

  Fly   351 NDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRVWMCGGVLEIAPCSRVGH 415
            ...| |:|:|.|.||:|:|::.||.|:|.||.||||.||||:|:|.|:|||||.|.|.||||||:
Mouse   278 GPST-PIRSPAMTGGIFAINRHYFNELGQYDNGMDICGGENVELSLRIWMCGGQLFILPCSRVGY 341

  Fly   416 VFRKSTPYTFPGGTTEIVNHNNARLVEVWLDDWKEFYYSFYPGARKASAGDVSDRKALRDRLKCK 480
            ..:..:.:.  ......::.|..|:|.||||::|..::...|.....|.|::|:|..||.||.||
Mouse   342 NSKALSQHR--RANQSALSRNLLRVVHVWLDEYKGNFFLQRPSLTYVSCGNISERVELRKRLGCK 404

  Fly   481 SFRWYLENVYPE 492
            ||:|||:|::||
Mouse   405 SFQWYLDNIFPE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant5NP_001036338.1 pp-GalNAc-T 190..490 CDD:133004 141/299 (47%)
Ricin_B_lectin 503..619 CDD:395527
Galntl5NP_080725.2 Catalytic subdomain A 114..224 58/109 (53%)
pp-GalNAc-T 118..414 CDD:133004 141/299 (47%)
Glyco_tranf_2_2 118..380 CDD:287123 124/265 (47%)
Catalytic subdomain B 282..344 38/61 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842587
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.